KEGG   Mus musculus (house mouse): 14768
Entry
14768             CDS       T01002                                 
Symbol
Lancl1, AW124738, Gpr69, Gpr69a, p40
Name
(RefSeq) LanC (bacterial lantibiotic synthetase component C)-like 1
  KO
K25210  glutathione transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00480  Glutathione metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14768 (Lancl1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14768 (Lancl1)
SSDB
Motif
Pfam: LANC_like Glyco_hydro_88 CitF
Other DBs
NCBI-GeneID: 14768
NCBI-ProteinID: NP_001177913
MGI: 1336997
Ensembl: ENSMUSG00000026000
UniProt: O89112
Position
1:complement(67039676..67078049)
AA seq 399 aa
MAQRAFPNPYADYNKSLAENYFDSTGRLTPEFSHRLTNKIRELLQQMERGLKSADPRDGT
GYTGWAGIAVLYLHLHNVFGDPAYLQMAHSYVKQSLNCLSRRSITFLCGDAGPLAVAAVL
YHKMNSEKQAEECITRLIHLNKIDPHVPNEMLYGRIGYIFALLFVNKNFGEEKIPQSHIQ
QICENILTSGENLSRKRNLAAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVNQGKL
HSLVKPSVDFVCRLKFPSGNYPPCLDDTRDLLVHWCHGAPGVIYMLIQAYKVFKEERYLC
DAQQCADVIWQYGLLKKGYGLCHGAAGNAYAFLALYNLTQDLKYLYRACKFAEWCLDYGE
HGCRTADTPFSLFEGMAGTIYFLADLLVPTKAKFPAFEL
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggctcagagggcctttccgaatccttatgccgattataacaagtcgctggccgaaaac
tactttgattctactgggaggctgactcctgagttctcacatcgcttgaccaataagatc
cgagagctccttcagcaaatggagagaggcctaaagtctgcagaccctcgggatggcact
gggtacactggctgggcaggcatcgctgtgctttacctccacctccacaatgtgtttggg
gacccagcctatctacagatggcgcacagctatgtaaagcaaagcctcaactgtctgagc
aggcgttccatcaccttcctgtgtggcgatgcgggccccctggctgtggctgctgtgctg
taccacaagatgaacagtgagaagcaggccgaggagtgcatcacacggctcattcaccta
aataagattgatccccacgtaccaaatgaaatgctctatggccgcataggctacatcttt
gctctgctttttgtcaataagaactttggagaggagaagattcctcagagccatattcag
cagatttgtgaaaacatcttaacctctggggaaaacctatctagaaagagaaacttggcg
gcaaagtctccactgatgtatgagtggtaccaggaatattacgtgggggctgctcatggc
ttggcaggcatttattactacctgatgcagcccagccttcaggtgaaccaaggaaagttg
catagtttggtgaagcccagtgtagactttgtctgccggctgaagtttccttccggcaat
taccctccatgtttggatgataccagagacctgcttgtccattggtgccacggtgctcct
ggggtcatctatatgctcatccaagcatacaaggtgttcaaagaagagcgttacctgtgt
gatgcccagcagtgtgctgacgtgatctggcagtacgggctactgaagaagggctacggg
ctgtgccatggtgctgcagggaatgcctacgctttcctggcactctacaacctcacacag
gatctgaagtatctgtacagggcctgcaagtttgctgagtggtgcttagactacggggag
cacggatgcaggacagcggacacccccttctccctctttgaagggatggctggaacaata
tatttcttggctgacctgttagtccccacaaaggccaagttccctgcatttgaactctga

DBGET integrated database retrieval system