KEGG   Mus musculus (house mouse): 14773
Entry
14773             CDS       T01002                                 
Symbol
Grk5, Gprk5
Name
(RefSeq) G protein-coupled receptor kinase 5
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14773 (Grk5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    14773 (Grk5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    14773 (Grk5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14773 (Grk5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     14773 (Grk5)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   14773 (Grk5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like Pkinase_fungal Sulfakinin
Other DBs
NCBI-GeneID: 14773
NCBI-ProteinID: NP_061357
MGI: 109161
Ensembl: ENSMUSG00000003228
Position
19:60877995..61084406
AA seq 590 aa
MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDLRRTIDRDYYSLCDKQ
PIGRLLFRQFCETRPGLECYIQFLDLVAEYEITPDENLGAKGKEIMTKYLTPKSPVFIAQ
VGQDLVSQTEKKLLQSPCKELFSACAQSVHDYLKGDPFHEYLDSMYFDRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRKGESMALNEKQILEK
VNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERALFYAAEILCGLE
DLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVGYMAPEVLNNQ
RYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSSKFSEEAKSIC
NMLLTKDSKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDI
EQFSTVKGVNLDHTDDDFYSKFSTGSVPIPWQNEMIETECFKELNVFGPNGTLSPDLNRS
QPPEPPKKGLFHRLFRRQHQSNSKSSPTPKTSCNHRINSNHINSNSTGSS
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggagctggaaaacatcgtggccaacacggtcttgctgaaagcccgggaagggggtgga
ggaaagcgcaaagggaaaagcaagaagtggaaggaaatcctgaagtttcctcacatcagc
cagtgtgaagacctccgaaggaccatagacagagattactacagtctatgtgacaagcaa
ccaattgggagactgctttttcgacagttctgtgaaaccaggcctgggctggagtgctac
attcagttcctggacttagtggcagaatatgaaattactccagatgaaaaccttggggcg
aaggggaaggaaataatgaccaagtacctcactccaaagtccccagtcttcattgcccaa
gttggacaggacctggtctcccagacagagaagaagctcctgcagagcccctgcaaagaa
ctcttctctgcttgtgctcagtctgtccatgactacttgaagggagaccccttccacgag
tacctggatagcatgtattttgaccgttttctgcagtggaaatggttagaaagacaacca
gtgaccaaaaacactttccggcagtaccgagtgctgggcaaagggggctttggagaggtc
tgtgcctgccaggttcgggccactggtaaaatgtatgcttgtaaacgcttagagaagaag
aggatcaaaaagaggaaaggcgaatccatggcactcaacgaaaagcagattcttgagaag
gtcaacagccagtttgtggtcaacctggcctatgcctatgaaaccaaagatgcactatgc
ctggttctgaccattatgaatggtggtgacctgaagtttcacatctacaatatggggaat
cctggctttgaggaagagcgagccttattttatgcagctgagatcctctgtggcctagaa
gacttacaccgtgagaacactgtctatagagatctaaaacccgaaaacatcttgctggat
gattatggccacataaggatctcagacctcggactggccgtgaagatccccgagggagac
cttatccgtggccgggtaggcactgttggctacatggccccagaagttctgaacaaccag
cgatatggactgagccctgactactggggcctgggctgcctcatctatgagatgattgaa
ggccagtcaccatttcgaggtcgcaaggagaaggttaagcgggaagaggtggatcgccgg
gtgctggagactgaggaagtgtattcctccaagttctctgaagaggccaagtccatctgc
aacatgctgctcaccaaagactcgaagcagaggctgggctgccaggaggagggggccgcc
gaggtcaagaggcaccctttcttcaggaacatgaactttaagcgcctggaggctgggatg
ttggaccctcccttcgttccagatccccgggctgtatactgcaaggatgtgctggacatt
gagcagttctccactgtgaaaggtgtcaacctggaccatacggacgatgatttttactca
aagttctctacaggctctgtgccaattccatggcaaaatgagatgatagaaacagaatgt
ttcaaggagctgaatgtgttcggacctaacggtaccctctcaccagacctgaacagaagt
cagcctccagaaccgccaaagaaagggctgttccacagactcttcaggcgtcagcatcaa
agcaattccaagagttcacctactcctaagaccagttgtaaccaccgaataaattcaaac
cacatcaattcaaactccactggaagcagctag

DBGET integrated database retrieval system