KEGG   Mus musculus (mouse): 14775
Entry
14775             CDS       T01002                                 

Gene name
Gpx1, AI195024, AL033363, CGPx, GPx-1, GSHPx-1, Gpx
Definition
(RefSeq) glutathione peroxidase 1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00590  Arachidonic acid metabolism
mmu01100  Metabolic pathways
mmu04918  Thyroid hormone synthesis
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    14775 (Gpx1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14775 (Gpx1)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    14775 (Gpx1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    14775 (Gpx1)
   05016 Huntington disease
    14775 (Gpx1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     14775 (Gpx1)
SSDB
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Other DBs
NCBI-GeneID: 14775
NCBI-ProteinID: NP_032186
MGI: 104887
Ensembl: ENSMUSG00000063856
Vega: OTTMUSG00000050754
UniProt: P11352
Position
9 F2; 9 59.24 cM
AA seq 201 aa
MCAARLSAAAQSTVYAFSARPLTGGEPVSLGSLRGKVLLIENVASLUGTTIRDYTEMNDL
QKRLGPRGLVVLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKA
HPLFTFLRNALPTPSDDPTALMTDPKYIIWSPVCRNDIAWNFEKFLVGPDGVPVRRYSRR
FRTIDIEPDIETLLSQQSGNS
NT seq 606 nt   +upstreamnt  +downstreamnt
atgtgtgctgctcggctctccgcggcggcacagtccaccgtgtatgccttctccgcgcgc
ccgctgacgggcggggagcctgtgagcctgggctccctgcggggcaaggtgctgctcatt
gagaatgtcgcgtctctctgaggcaccacgatccgggactacaccgagatgaacgatctg
cagaagcgtctgggacctcgtggactggtggtgctcggtttcccgtgcaatcagttcgga
caccaggagaatggcaagaatgaagagattctgaattccctcaagtacgtccgacctggt
ggcgggttcgagcccaattttacattgtttgagaagtgcgaagtgaatggtgagaaggct
cacccgctctttaccttcctgcggaatgccttgccaacacccagtgacgaccccactgcg
ctcatgaccgaccccaagtacatcatttggtctccggtgtgccgcaacgacattgcctgg
aactttgagaagttcctggtgggccccgacggtgttcccgtgcgcaggtacagccgccgc
tttcgtaccatcgacatcgaacctgacatagaaaccctgctgtcccagcagtctggcaac
tcctaa

DBGET integrated database retrieval system