KEGG   Mus musculus (mouse): 14776
Entry
14776             CDS       T01002                                 

Gene name
Gpx2, GI-GPx, GPx-GI, GSHPx-2, GSHPx-GI
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00590  Arachidonic acid metabolism
mmu01100  Metabolic pathways
mmu04918  Thyroid hormone synthesis
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    14776 (Gpx2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14776 (Gpx2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    14776 (Gpx2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    14776 (Gpx2)
   05016 Huntington disease
    14776 (Gpx2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     14776 (Gpx2)
SSDB
Motif
Pfam: GSHPx
Other DBs
NCBI-GeneID: 14776
NCBI-ProteinID: NP_109602
MGI: 106609
Ensembl: ENSMUSG00000042808
UniProt: Q9JHC0
Position
12 C3; 12 33.73 cM
AA seq 190 aa
MAYIAKSFYDLSAVGLDGEKIDFNTFRGRAVLIENVASLUGTTTRDYNQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFSLTQKCDVNGQNEHPVFAYLK
DKLPYPYDDPFSLMTDPKLIIWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRSFQTINIEP
DIKRLLKVAI
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcttacattgccaagtcgttctacgatctcagtgccgttggcctggatggggagaag
atagacttcaatacgttcagaggcagggctgtgctgattgagaatgtggcgtcactctga
ggaacaactacccgggactacaaccagctcaatgagctgcaatgtcgctttcccaggcgc
ctggtagttctcggcttcccttgcaaccagttcggacatcaggagaactgtcagaacgag
gagatcctgaacagcctcaagtatgtccgacctgggggtgggtaccagcccacctttagt
cttacccaaaagtgtgacgtcaatgggcagaacgagcatcctgtctttgcctacctgaaa
gacaagctgccctacccttatgatgacccgttctccctcatgaccgatcccaagctcatc
atatggagtcccgtgcgccgctcagacgtgtcctggaactttgagaagttcctcataggg
ccagaaggggagcccttccgtcgctacagccgcagcttccagaccatcaacatcgagcct
gacatcaaacggctcctcaaagttgccatctag

DBGET integrated database retrieval system