KEGG   Mus musculus (mouse): 14780Help
Entry
14780             CDS       T01002                                 

Gene name
Gpx5, AV379049, Arep
Definition
(RefSeq) glutathione peroxidase 5
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00590  Arachidonic acid metabolism
mmu01100  Metabolic pathways
mmu04918  Thyroid hormone synthesis
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    14780 (Gpx5)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14780 (Gpx5)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    14780 (Gpx5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    14780 (Gpx5)
   05016 Huntington disease
    14780 (Gpx5)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     14780 (Gpx5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 14780
NCBI-ProteinID: NP_034473
MGI: 104886
Ensembl: ENSMUSG00000004344
Vega: OTTMUSG00000000743
UniProt: P21765 Q496Q2 Q8CDQ5 Q8CC60
Position
13 A3.1; 13 7.73 cM
AA seq 221 aa AA seqDB search
MVTELRVFYLVPLLLASYVQTTPRPEKMKMDCYKDVKGTIYDYEALSLNGKEHIPFKQYA
GKHVLFVNVATYCGLTIQYPELNALQEDLKPFGLVILGFPCNQFGKQEPGDNLEILPGLK
YVRPGKGFLPNFQLFAKGDVNGENEQKIFTFLKRSCPHPSETVVMSKHTFWEPIKVHDIR
WNFEKFLVGPDGIPVMRWFHQAPVSTVKSDIMAYLSHFKTI
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggttacagagttaagagtcttctatcttgttccacttcttctagccagctatgtgcag
acaacccccaggccggaaaagatgaagatggactgctacaaagatgtgaaaggcaccatc
tacgactatgaggctctgtctcttaatgggaaggaacacattccattcaagcagtatgca
ggaaagcacgtcctctttgtcaatgtggctacctattgcggtctgacaatccagtaccct
gagctgaatgcactccaggaggatctgaagccatttggcttggttatattgggctttccc
tgcaaccaatttggaaagcaagaaccaggagacaatttagagattcttcctgggctcaag
tatgttcgtccaggaaaagggtttttacctaacttccagctttttgcaaaaggggatgta
aatggtgaaaacgagcagaaaatcttcaccttcttgaagcgttcttgtcctcacccctca
gagactgtggtcatgagcaaacataccttctgggagccaataaaagtccatgacatccgc
tggaactttgagaagttcctggtgggacccgatggcatccctgtcatgcgctggttccac
caggctcctgtcagcactgtcaagtctgacatcatggcgtacctgagccatttcaaaacc
atatag

DBGET integrated database retrieval system