KEGG   Mus musculus (mouse): 14783
Entry
14783             CDS       T01002                                 

Symbol
Grb10, 5730571D09Rik, AI325020, Meg1, mKIAA0207
Name
(RefSeq) growth factor receptor bound protein 10
  KO
K20064  growth factor receptor-bound protein 10
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    14783 (Grb10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14783 (Grb10)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    14783 (Grb10)
SSDB
Motif
Pfam: BPS SH2 RA PH PH_9
Other DBs
NCBI-GeneID: 14783
NCBI-ProteinID: NP_034475
MGI: 103232
Ensembl: ENSMUSG00000020176
Vega: OTTMUSG00000005165
UniProt: Q60760
Structure
PDB: 
3M7F

Position
11 A1; 11 7.15 cM
AA seq 596 aa
MNNDINSSVESLNSACNMQSDTDTAPLLEDGQHASNQGAASSSRGQPQASPRQKMQRSQP
VHILRRLQEEDQQLRTASLPAIPNPFPELTGAAPGSPPSVAPSSLPPPPSQPPAKHFPPG
FQLSKLTRPGLWTKTTARFSKKQPKNQCPTDTVNPVARMPTSQMEKLRLRKDVKVFSEDG
TSKVVEILTDMTARDLCQLLVYKSHCVDDNSWTLVEHHPQLGLERCLEDHEIVVQVESTM
PSESKFLFRKNYAKYEFFKNPVNFFPDQMVNWCQQSNGGQAQLLQNFLNTSSCPEIQGFL
QVKEVGRKSWKKLYVCLRRSGLYYSTKGTSKEPRHLQLLADLEESSIFYLIAGKKQYNAP
NEHGMCIKPNKAKTEMKELRLLCAEDEQIRTCWMTAFRLLKYGMLLYQNYRIPQRKGLPP
PFNAPMRSVSENSLVAMDFSGQIGRVIDNPAEAQSAALEEGHAWRKRSTRMNILSSQSPL
HPSTLNAVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQK
IKNFQILPCEDDGQTFFTLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgaacaacgatattaactcgtccgtggaaagccttaactcagcttgcaacatgcagtct
gatactgatactgcaccacttcttgaggatggccagcatgccagcaaccagggagcagca
tctagctcccggggacagccacaggcgtccccgaggcagaaaatgcaacgctcgcagcct
gtgcacattctcaggcgccttcaggaggaagaccagcagttaagaactgcatctcttccg
gccatccccaacccatttccggagctcactggtgcggcccctgggagccctccttcggtt
gctcctagctccttacctcctcctccgagccagccacctgccaagcatttccctccaggc
tttcagctgtcgaaactcacccgtccaggtctgtggacaaagaccactgcgagattttca
aagaaacaacctaagaaccagtgtccaaccgacactgtgaatccagtggcacggatgccc
acttcacagatggagaagctgaggctcagaaaggatgtcaaagtctttagtgaagatggg
accagcaaagtggtggagattctaaccgacatgacagccagggacctgtgccagctgctg
gtttacaaaagtcactgtgtggatgacaacagctggactctggtggaacaccacccacaa
ctgggattagagaggtgcctggaggaccatgagatcgtggtccaagtggagagtaccatg
ccaagtgagagcaaattcttattcagaaagaattatgcgaagtacgagttctttaagaat
ccagtgaacttcttcccggatcagatggtcaattggtgccagcagtccaacggtggccag
gcgcagcttctgcagaattttctgaacaccagcagctgccctgagatccaggggttcttg
caggtgaaagaggtaggacgcaagtcttggaagaagctgtatgtgtgcctgcgcagatct
ggcctctattactccaccaaggggacttcaaaagaacccagacacctgcagctgctggct
gacctggaagaaagcagcatcttctacctgattgctggaaagaagcagtacaacgcgccg
aatgaacatgggatgtgcatcaagccaaacaaagcgaagaccgagatgaaggagcttcgt
ctgctctgtgccgaagatgagcagatccgtacttgctggatgactgccttcagactgctc
aagtacggaatgctcctgtaccaaaactatcgcatcccacagaggaagggtctgccccct
cctttcaacgcacctatgcgcagtgtttctgagaattctcttgtggccatggatttttct
ggacaaatcggaagagtgatcgataacccggctgaagcccagagtgctgccctggaagag
ggccatgcctggcgtaagcggagcacacggatgaatatcctaagcagccaaagcccactg
catccttctaccctgaatgcagtgattcacaggactcagcattggttccatggacgtatc
tcccgcgaggagtctcacaggatcatcaagcaacaaggtctcgtggacgggctgttcctc
cttcgtgacagccagagtaatccaaaggcgttcgtactgacactgtgccatcaccagaag
attaaaaacttccagatcttaccttgcgaggatgatgggcagaccttcttcactctggat
gatgggaacaccaagttctccgatctgatccagctggtcgacttctaccagctcaacaaa
ggtgttctgccctgcaagctgaaacaccactgcatccgcgtggccttatga

DBGET integrated database retrieval system