KEGG   Mus musculus (mouse): 14786
Entry
14786             CDS       T01002                                 

Symbol
Grb7, mKIAA4028
Name
(RefSeq) growth factor receptor bound protein 7
  KO
K23695  growth factor receptor-bound protein 7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    14786 (Grb7)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   14786 (Grb7)
SSDB
Motif
Pfam: BPS SH2 RA PH
Other DBs
NCBI-GeneID: 14786
NCBI-ProteinID: NP_034476
MGI: 102683
Ensembl: ENSMUSG00000019312
Vega: OTTMUSG00000006361
UniProt: Q03160
Position
11 D; 11 61.75 cM
AA seq 535 aa
MELDLSPTHLSSSPEDVCPTPATPPETPPPPDNPPPGDVKRSQPLPIPSSRKLREEEFQA
TSLPSIPNPFPELCSPPSQKPILGGSSGARGLLPRDSSRLCVVKVYSEDGACRSVEVAAG
ATARHVCEMLVQRAHALSDESWGLVESHPYLALERGLEDHEFVVEVQEAWPVGGDSRFIF
RKNFAKYELFKSPPHTLFPEKMVSSCLDAQTGISHEDLIQNFLNAGSFPEIQGFLQLRGS
GRGSGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRKLYGMPT
DFGFCVKPNKLRNGHKGLHIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQSRHLRLS
YLGSPPLRSVSDNTLVAMDFSGHAGRVIDNPREALSAAMEEAQAWRKKTNHRLSLPTTCS
GSSLSAAIHRTQPWFHGRISREESQRLIGQQGLVDGVFLVRESQRNPQGFVLSLCHLQKV
KHYLILPSEDEGCLYFSMDEGQTRFTDLLQLVEFHQLNRGILPCLLRHCCARVAL
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggaactggatctgagcccgactcatctcagcagctccccagaagatgtgtgcccaact
cctgctacccctcctgagactcctccgccccctgataaccctccgccaggggatgtgaag
cggtcgcagcctttgcccatccccagcagcaggaaacttcgagaagaggagtttcaggca
acctctctgccttccatccccaaccccttccctgagctctgcagcccaccttcacagaaa
cccattcttggtggttcctccggtgcaagggggttgcttcctcgagactccagccgcctc
tgtgtggtgaaggtgtacagtgaggatggggcctgccggtctgtggaggtggcagcgggc
gccacagctcgtcacgtgtgtgagatgctggtacagcgagctcacgccctgagcgacgag
agctggggactagtggaatcccacccctacctggcactggagcggggtctggaggaccat
gaatttgtggtggaagtgcaggaggcctggcctgtgggtggagacagccgcttcatcttt
cgtaaaaacttcgccaagtatgaactattcaagagccccccacacaccctgttcccagaa
aagatggtctcgagctgtctggatgcacaaacaggcatatcccatgaagacctcatccag
aacttcctgaacgctggcagcttccctgagatccagggcttcctgcagctgcggggatca
ggccgggggtcaggtcgaaagctttggaaacgtttcttctgctttctgcgtcgatctggc
ctctactactctaccaagggtacctccaaggaccccagacacctacagtatgtggcagat
gtgaatgagtccaatgtctatgtggtgacccagggccgcaagctgtatgggatgcccact
gacttcggcttctgtgtcaagcccaacaagcttcgaaacggccacaaggggctccacatc
ttctgcagtgaggatgagcagagtcggacctgctggctggctgccttccggctcttcaag
tacggggtacagctatataagaattatcagcaggcccagtctcgtcacctgcgcctatcc
tatttggggtctccacccttgaggagcgtctcagacaataccctagtggctatggacttc
tctggccatgcggggcgtgtcattgataacccccgggaagctctgagtgccgccatggag
gaggcccaggcctggaggaagaagacaaaccaccgtctgagcctgcccaccacatgctct
ggctcgagcctcagcgcagccattcatcgcacccagccctggtttcatggacgcatctct
cgggaggagagccagcggctaattggacagcagggcctggtggatggtgtgttcctggtc
cgggagagccagaggaacccacagggctttgtcctgtccttgtgccatctgcagaaagtc
aagcattatctcattttgccaagcgaagatgaaggttgcctttacttcagcatggatgag
ggccagacccgtttcacagacctgctgcagctggtagaattccaccagctgaaccgaggc
atcctgccctgcctgctgcgccactgctgtgcccgtgtggccctctga

DBGET integrated database retrieval system