KEGG   Mus musculus (mouse): 14799Help
Entry
14799             CDS       T01002                                 

Gene name
Gria1, 2900051M01Rik, Glr-1, Glr1, GluA1, GluR-A, GluRA, Glur-1, Glur1, HIPA1, gluR-K1
Definition
(RefSeq) glutamate receptor, ionotropic, AMPA1 (alpha 1)
  KO
K05197  glutamate receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05031  Amphetamine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    14799 (Gria1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14799 (Gria1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    14799 (Gria1)
   04728 Dopaminergic synapse
    14799 (Gria1)
   04720 Long-term potentiation
    14799 (Gria1)
   04730 Long-term depression
    14799 (Gria1)
   04723 Retrograde endocannabinoid signaling
    14799 (Gria1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    14799 (Gria1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    14799 (Gria1)
   05016 Huntington disease
    14799 (Gria1)
   05017 Spinocerebellar ataxia
    14799 (Gria1)
  09165 Substance dependence
   05031 Amphetamine addiction
    14799 (Gria1)
   05033 Nicotine addiction
    14799 (Gria1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    14799 (Gria1)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   14799 (Gria1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 14799
NCBI-ProteinID: NP_001106796
MGI: 95808
Ensembl: ENSMUSG00000020524
Vega: OTTMUSG00000005703
UniProt: P23818 Q7TNB5
Position
11 B1.3; 11 34.51 cM
AA seq 907 aa AA seqDB search
MPYIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASGGSGSGENGRVVSQDFPKSMQSIPCMSHSSGM
PLGATGL
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacatctttgcctttttctgcaccggttttctaggtgcggttgtgggtgccaat
ttccccaacaatatccagatagggggattatttccaaaccaacaatcacaggaacatgcg
gcttttaggtttgctttgtcacaactcacggagccccccaagctgcttccccagatcgat
attgtgaacatcagcgacagctttgagatgacttaccgattctgttcccagttctccaaa
ggagtgtacgccatctttggattttatgaacgaaggactgtcaacatgctgacctccttc
tgtggggccctccatgtgtgcttcatcactccaagttttcccgttgacacatccaatcag
tttgtccttcagctgcgcccggaactacaggaagctctcattagcattatcgaccattac
aagtggcagacttttgtctacatttatgatgctgaccggggcctgtcagtcctgcagaga
gtcttggatacagccgccgagaagaactggcaggtgacggctgtcaacattctaacaacc
acggaggaaggataccggatgctctttcaggacctggagaagaaaaaggagaggctggtg
gtggtggactgtgaatcagaacgcctcaacgccatcctgggccagattgtgaagctagaa
aagaacggcatcgggtaccactacatcctcgccaacctgggcttcatggacattgactta
aataagttcaaggagagtggagccaatgtgacaggtttccaactggtgaactacacagac
acgatcccagccagaatcatgcagcagtggaggacaagtgacgctcgggaccacaccagg
gtggactggaagaggccaaagtacacttctgctcttacctatgatggtgtgaaggtgatg
gcggaggccttccagagcctgcggaggcagaggattgacatatcccggcgagggaatgct
ggggactgtctggctaacccagctgtgccctggggccaagggatcgacatccagagagcc
ctgcagcaggtgcgctttgaaggtttgacaggaaatgtgcagtttaacgagaaagggcgc
cggaccaactacaccctccatgtgatcgaaatgaagcatgatggaatccgcaagattggt
tactggaatgaagatgataaatttgtccccgcagccacggacgctcaggctggaggggac
aactcaagcgtccagaatagaacctacatcgtcacgactatcctcgaagatccttacgtg
atgcttaaaaagaatgccaaccaatttgaaggcaatgaccgctatgagggctactgcgtg
gaactggctgcggagatcgccaagcacgtgggctattcctaccgacttgagattgtcagc
gacggcaaatacggagcccgggatcctgacacaaaggcctggaatggcatggtgggagag
ctagtctatggaagagcagatgtggcggtggcccccttgaccataaccttggtccgggag
gaagtcatcgacttctccaagccattcatgagtttgggaatctccattatgattaagaag
ccacagaagtccaagccaggtgtcttctcctttcttgaccctttggcctacgagatctgg
atgtgtatagtgtttgcctacattggagtgagcgtcgtcctcttcctggtcagccgtttc
agtccttatgaatggcacagtgaagagtttgaagaaggacgagatcagacaaccagtgac
cagtcaaatgagtttggcatattcaacagcctgtggttctcgctgggggccttcatgcag
caaggatgtgacatttcccccaggtccctgtctggacgcatcgtcggcggtgtctggtgg
ttcttcactttgattatcatctcctcatacacagccaacctggctgccttcctgactgtg
gaaaggatggtgtctcccatcgagagtgcagaggacctggcaaagcagacggaaattgct
tatgggacattggaagcaggatccactaaggagttcttcaggaggtctaaaatcgctgtg
tttgagaagatgtggacatacatgaagtctgcagaaccgtctgtgtttgttcggaccaca
gaggagggcatgatcagagtgagaaagtctaaaggcaaatatgcctacctcctggagtcc
accatgaatgagtacattgagcaacgcaagccctgtgacaccatgaaagtgggaggtaac
ttggattccaaaggctatggcattgcaacacccaaggggtccgccctgagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaagaccagtgct
ctgagcctgagcaatgtggcaggcgtgttctacatcctgattggagggctgggattggcc
atgctggttgccttaatcgagttctgctacaaatcccgtagcgagtcgaagcggatgaag
ggtttctgtttgattccacagcaatccatcaatgaagccatacggacatcgaccctcccc
aggaacagcggggcaggagccagcggaggaagtggcagtggagagaatggcagagtggtc
agccaggacttccccaagtccatgcaatccattccctgcatgagccacagttcagggatg
cccttgggagccacaggattgtaa

DBGET integrated database retrieval system