KEGG   Mus musculus (mouse): 14802
Entry
14802             CDS       T01002                                 

Gene name
Gria4, GluA4, GluR-D, Glur-4, Glur4, Gluralpha4, spkw1
Definition
(RefSeq) glutamate receptor, ionotropic, AMPA4 (alpha 4)
  KO
K05200  glutamate receptor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04713  Circadian entrainment
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04728  Dopaminergic synapse
mmu05016  Huntington disease
mmu05031  Amphetamine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    14802 (Gria4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14802 (Gria4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    14802 (Gria4)
   04728 Dopaminergic synapse
    14802 (Gria4)
   04723 Retrograde endocannabinoid signaling
    14802 (Gria4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    14802 (Gria4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    14802 (Gria4)
  09165 Substance dependence
   05031 Amphetamine addiction
    14802 (Gria4)
   05033 Nicotine addiction
    14802 (Gria4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    14802 (Gria4)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   14802 (Gria4)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 DUF2061
Other DBs
NCBI-GeneID: 14802
NCBI-ProteinID: NP_001106651
MGI: 95811
Ensembl: ENSMUSG00000025892
Vega: OTTMUSG00000061694
UniProt: Q9Z2W8 Q8C069
Position
9 A1; 9 2.46 cM
AA seq 902 aa
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDAPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGL
LDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP
NT seq 2709 nt   +upstreamnt  +downstreamnt
atgaggattatttgcaggcagattgtcttgttgttttctggattttggggactcgccatg
ggagcctttccgagcagcgttcaaataggtggtctctttatccgaaacacagaccaggaa
tacactgcttttcggctagctatctttcttcataacaccagccccaatgcatctgaagcc
cctttcaatttggtacctcatgtggacaacattgagactgccaacagttttgctgtgaca
aatgcattctgttcccagtattctagaggggtgtttgccatttttggactctatgacaag
aggtcagtgcataccttgacctccttctgcagtgctctgcacatctctctcatcacacca
agcttccccactgaaggagagagccagttcgtgcttcagctaagaccttcattgagaggt
gcactcctgagcctcctggatcactatgaatggaattgttttgtcttcctgtatgataca
gacagggggtattcaatacttcaagctataatggaaaaagcaggacagaatggatggcat
gtcagtgcgatatgtgtggaaaattttaacgatgtcagctacaggcaactactagaagag
cttgacagaagacaagagaagaaatttgtaatagattgtgagatagaaaggcttcaaaac
atattagaacaaattgtgagtgttgggaagcacgtcaaaggctaccattatatcatcgca
aatttgggtttcaaagatatttctcttgagagatttatacatggaggagcaaatgtcact
ggattccagttagtagattttaatacgcccatggtgacgaaactaatggatcgctggaag
aaactagatcaacgagaatatccaggatctgaaacacctccaaagtacacttctgctctc
acttacgatggtgtcttggtaatggctgaaactttccgaagtctcagaagacagaaaatt
gatatttcaaggagaggaaatgccggggattgtctggcaaaccctgctgctccctggggc
cagggaattgacatggagagaacactgaagcaggttcgaattcaaggactgactgggaat
gttcaatttgaccactatggacgtagagttaattacacaatggatgtgtttgaattaaaa
agcacaggacctcgaaaggttggctattggaacgatatggataaattagtcttgattcaa
gatgcgcctactcttggcaatgacacagcagctatcgagaacagaacagtggttgtaacc
acaattatggaatccccctacgttatgtacaagaaaaatcatgaaatgtttgaaggaaat
gacaagtatgaaggctactgtgtagacttggcatctgaaattgcgaaacatatcggtatc
aaatataaaattgccattgtccctgatggaaaatatggagcaagggatgcggacaccaaa
atttggaatgggatggtaggagagcttgtgtatgggaaagcagagattgccattgcacct
ctgacaatcacgttggtgcgagaggaggtcatcgacttttctaagccttttatgagttta
ggcatctctatcatgatcaaaaaacctcagaaatctaaaccaggagtgttttccttcttg
gaccctctggcctatgagatctggatgtgcatagtgtttgcatacattggtgtcagcgtg
gtcttgttcctagtcagtaggtttagcccatatgagtggcacacagaagagcctgaggat
ggaaaagaaggacccagtgaccaacctcccaatgagtttggcatctttaacagcctctgg
ttttccctgggtgcctttatgcaacaaggatgtgacatttcacccagatccctgtccggt
cggattgttggaggcgtatggtggttcttcactctcatcattatctcatcctacactgct
aatctggctgcattcctgacagtggagagaatggtctcccccatagaaagtgcagaagac
ctggccaaacaaacagaaattgcctatggaacacttgattcgggatcaacaaaagaattc
ttcagaagatcaaaaatagcagtatatgaaaagatgtggacctacatgcgatcggcagag
ccatctgtgttcactagaactacagctgagggcgtggcccgtgtccgcaagtccaagggc
aaatttgccttcctcctggagtccacgatgaatgaatacattgagcagcgaaagccctgt
gacacgatgaaagtgggaggaaacctggattccaaaggctatggtgtagcgacgcccaag
ggttcctcattaagaaatgctgttaacctcgcagttttaaaactgaatgaacaaggcctc
ttggacaaattgaaaaacaaatggtggtacgacaaaggagaatgtggcagcgggggaggt
gactccaaggacaagacgagtgccttgagcctgagcaacgtagcaggcgtcttctacatt
ctggttggcggcttgggcttggcaatgctggtggctttgatagagttctgttacaagtcc
agggcagaggcgaagagaatgaagctgactttttccgaagccataagaaacaaagccagg
ttatccatcactgggagtgtgggagaaaacggccgtgtgctgacccccgactgccccaag
gccgtacacacaggaactgcgattagacagagctcgggattggctgtcattgcatcggac
ctaccataa

DBGET integrated database retrieval system