KEGG   Mus musculus (mouse): 14804
Entry
14804             CDS       T01002                                 

Gene name
Grid2, B230104L07Rik, GluD2, GluRdelta2, Lc, Lc<J>, MMS10-AC, Ms10ac, cpr, ho, nmf408, tpr
Definition
(RefSeq) glutamate receptor, ionotropic, delta 2
  KO
K05207  glutamate receptor delta-2 subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04730  Long-term depression
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14804 (Grid2)
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    14804 (Grid2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    14804 (Grid2)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   14804 (Grid2)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 ApeA_NTD1 Desmo_N RNase_H
Other DBs
NCBI-GeneID: 14804
NCBI-ProteinID: NP_032193
MGI: 95813
Ensembl: ENSMUSG00000071424
Vega: OTTMUSG00000034292
UniProt: Q61625
Position
6 C1; 6 29.77 cM
AA seq 1007 aa
MEVFPLLLFLSFCWSRTWDLATADSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQT
EKITFSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQ
RSTAGTPRSGCGLTRSNRNDDYTLSVRPPVYLNEVILRVVTEYAWQKFIIFYDSEYDIRG
IQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAK
SFISEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFR
GNHRISSSLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNS
KPWQGGRSMLETIKKGGVNGLTGDLEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWN
PVTGLNGSLTDKKLENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSN
YLGFNYEIYVAPDHKYGSPQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRY
MDYSVGVLLRRAEKTVDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSM
TSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITR
IESSIQSLQDLSKQTDIPYGTVLDSAVYQHVRMKGLNPFERDSMYSQMWRMINRSNGSEN
NVLESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTVGNTVADRGYGIALQHGSPY
RDVFSQRILELQQSGDMDILKHKWWPKNGQCDLYSSVDAKQKGGALDIKSLAGVFCILAA
GIVLSCLIAVLETWWSRRKGSRVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSI
DLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFAFGSVPEH
RTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
NT seq 3024 nt   +upstreamnt  +downstreamnt
atggaagttttccccttgctcttgtttctgtccttctgttggtctcgaacctgggacctg
gcgaccgctgattctatcatccacatcggagcaatttttgatgaatctgctaaaaaagat
gatgaagtattccgcacagcagttggtgacctcaaccagaatgaggaaatcttacagact
gagaaaatcacattttctgtgacgtttgttgatggcaacaacccttttcaagctgttcaa
gaagcatgtgaacttatgaaccagggcatcttggccttggtcagctccattggttgcaca
tcagctgggtccctccagtctttggcagatgccatgcatatcccccacctcttcattcag
cgctcaacagctgggaccccaagaagtggctgtggcctcacccggagcaacagaaatgat
gactatactctttcagttcgtccacctgtctacttgaatgaagtcatcctaagagtagtc
acagagtatgcatggcagaaatttattatcttctatgacagtgaatatgatatccgtgga
atccaggaatttttggacaaagtatcccagcagggaatggatgttgcccttcaaaaggtg
gaaaacaacatcaacaaaatgatcaccacactctttgacaccatgaggatagaggagttg
aatcgctatcgagacactcttagaagagccatccttgtcatgaatcctgccacagccaaa
tccttcataagtgaggtggtggagacgaatctggttgcttttgactgtcactggatcatc
attaatgaggaaataaatgatgtggatgttcaggaacttgtcagaaggtccattggaagg
ttaacaataattcggcagacatttccagtcccccagaatataagtcagcgctgtttccgt
ggcaaccatcgaatttcttcatcactgtgtgatccgaaggatccctttgcacagaatatg
gagatttctaacctttacatctatgacacggtgcttctgcttgcgaatgccttccataag
aagctggaggaccgtaagtggcacagcatggcaagcttgtcctgtatcaggaaaaactcc
aagccctggcaaggagggcggtccatgctggagaccatcaagaagggtggagttaatgga
ttgactggagatctagaatttggagaaaatggaggtaaccccaatgtccactttgaaatc
cttggaaccaactatggagaagaacttggcaggggtgtccgtaaacttgggtgctggaat
cctgtcacaggtctgaatggatcactgacagacaaaaaactggagaacaacatgcggggc
gtggttctacgagtggtgactgtattggaggagccttttgtaatggtctctgaaaatgtc
ttgggaaaaccgaagaaataccagggcttctccattgatgttttggatgccctatctaac
tacctgggttttaattatgaaatttatgttgcaccggaccacaaatatggaagcccacaa
gaggatgggacatggaatggactggtaggagaacttgtttttaagagagctgacattggg
atttcagctttaaccatcactccagaccgggagaatgttgtagattttacaacacgctac
atggactactcagtgggagtccttcttcgaagggcagaaaaaacagtggatatgtttgcc
tgccttgcaccatttgatctatctctgtgggcctgcattgctggcacagtgcttcttgtg
ggactcttggtctacctcttaaactggcttaatcccccacgattgcaaatgggatcgatg
acatctactacactctacaactccatgtggtttgtgtatgggtcctttgtacagcaaggt
ggggaagtcccatacacaactctggcaacccgaatgatgatgggggcttggtggttattt
gctctgattgtcatctcatcttatacagccaaccttgccgctttcctcactatcacccgc
attgagagctccatccagtctcttcaggatctgtccaagcaaacagatatcccttatggc
acagtcttggactcggcagtatatcagcatgtccgcatgaaggggctgaatcctttcgag
agagacagcatgtattcccagatgtggaggatgatcaaccgaagcaatgggtcagaaaac
aatgttttggagtcccaagcaggcattcaaaaggtaaaatatggaaactatgcttttgta
tgggatgcagctgtgttggaatatgtggctattaacgaccccgactgttccttctacact
gttgggaacactgttgctgaccgggggtatggcattgcactgcagcatggcagcccctac
cgtgatgtcttttcacaaaggatcctggagctgcagcagagtggcgacatggacattctc
aagcacaaatggtggcctaagaacggccagtgtgacctgtactcctcagtggatgcaaag
cagaagggaggagccttggacatcaagagcctggcaggcgtgttctgcatcctggccgcg
ggaattgtgctctcctgcctcatagctgtcctcgagacgtggtggagccggaggaagggc
tcccgggtcccatcgaaagaggatgacaaggaaattgacctggagcacctccatagacgt
gtaaatagcttgtgcacagatgacgacagcccccataaacagttttccacctcgtcaatt
gacttgacccctctggacattgacactttgccaacacgccaagccctggagcagatcagt
gatttcagaaacactcacatcaccaccaccaccttcatcccagagcagatccagactctt
agccgcacactctcagcaaaagctgcctctggcttcgctttcggcagtgtgcctgagcac
cgaactggcccttttaggcacagggctcctaatgggggctttttcaggagtcctatcaaa
acaatgtcatctattccttatcagcctactcccactctggggctcaatctgggcaatgac
cccgaccgaggcacgtccatatga

DBGET integrated database retrieval system