KEGG   Mus musculus (mouse): 14809
Entry
14809             CDS       T01002                                 

Gene name
Grik5, GluK5, GluRgamma2, KA2
Definition
(RefSeq) glutamate receptor, ionotropic, kainate 5 (gamma 2)
  KO
K05205  glutamate receptor, ionotropic kainate 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14809 (Grik5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    14809 (Grik5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    14809 (Grik5)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   14809 (Grik5)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Other DBs
NCBI-GeneID: 14809
NCBI-ProteinID: NP_032194
MGI: 95818
Ensembl: ENSMUSG00000003378
Vega: OTTMUSG00000058241
UniProt: Q61626 Q80WU3
Position
7 A3; 7 13.73 cM
AA seq 979 aa
MPAELLLLLIVAFANPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAK
ARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKV
GPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRG
FLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLVLRKASELGMTSAFY
KYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYPGP
ALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTG
RVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT
TILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS
WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLD
PFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPV
GGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLAD
QTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFL
LESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKR
KWWEGGRCPKEEDHRAKGLGMENIGGIFVVLICGLIIAVFVAVMEFIWSTRRSAESEEVS
VCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAG
AHGGPQRLLDDPGPPGGPRPQAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGTPAEAT
SPPRPRPGPTGPRELTEHE
NT seq 2940 nt   +upstreamnt  +downstreamnt
atgccggctgagctgctgctgctgctgatagtcgccttcgccaatcccagctgccaggtg
ctgtcatcactgcgcatggctgcaatcctggacgaccagaccgtgtgtggccgtggtgag
cgtctggccctggccctggcccgagagcagatcaatgggatcatcgaggtcccagccaag
gccagagtggaagtagacatctttgagctgcagcgggacagccagtacgagaccacggac
accatgtgtcagatcctgcccaagggggttgtatctgtcttgggaccctcctccagccca
gcttctgcctccaccgtgagccatatctgtggggagaaggagattccccacatcaaggtg
ggtcctgaggagacgccccgccttcagtaccttcgcttcgcatctgtcagcctgtacccc
agtaatgaagatgtcagcctggcagtctcccgaatcctcaagtcctttaactacccctca
gctagcctcatctgcgccaaggctgagtgcctgctgcggctagaagaactggtgcgaggc
ttcctcatctccaaggagacactgtccgtgaggatgcttgatgacagccgggaccccacg
ccgctactcaaggagatccgagatgacaaagtgtccaccatcatcattgatgccaatgcg
tccatctcccaccttgtcctccgtaaggcttcggagctgggaatgacctcagcgttttac
aagtacatcctcaccaccatggactttcccatcctgcatctggatggtatcgtggaggac
tcctccaacatcctgggcttttccatgttcaacacctcccaccccttctacccagagttt
gtgcgcagcctcaacatgtcctggagggagaactgtgaagccagcacctatcctggccct
gcgctgtccgcagccctgatgtttgacgctgtgcacgtggtggtaagcgctgtccgagaa
ctgaaccgaagccaggagattggcgtcaagccactggcctgcacttcggccaacatttgg
ccccatgggaccagccttatgaactaccttcgaatggtagagtatgacgggctgaccggg
cgggttgagttcaacagcaaagggcagaggaccaactacacactacgcatcctggagaag
tcccgccagggccaccgtgagataggggtgtggtactctaaccggaccctggccatgaat
gccaccaccctggacatcaacctgtcacagactctagccaacaagactctggtggtcaca
actatcctggagaacccgtatgttatgcgccggcccaacttccaggccttgtcagggaat
gagcgcttcgagggcttctgcgtggacatgctcagggagctggccgagctgctgcgcttc
cgataccgcctgcggttggtagaggacggactctacggggcacctgagcccaacggttcc
tggacaggcatggttggagaactcatcaaccggaaggcagacctggctgtggcagccttc
accatcaccgccgagagggagaaggtcatcgacttctccaagcccttcatgaccctgggg
atcagcatcctctacagggtgcacatgggccgcaagcctggctacttctccttcctggac
cccttctcccctgccgtgtggctcttcatgcttcttgcctacctggctgtcagctgtgtc
ttgttcctggctgccaggctgagcccttatgagtggtacaacccacacccgtgtctccgg
gcgcgtccccatatcctggagaaccagtacacgctgggcaacagcctctggttccccgtg
ggtggcttcatgcagcagggctcggagatcatgccgcgggcactgtccacacgctgtgtc
agcggagtctggtgggccttcaccttgatcatcatctcctcctacacggccaacctggct
gccttcctcacggtgcagcgcatggaggtgccggtggagtcggctgacgacctggcggat
cagaccaacattgagtacggcactatccacgctggctccaccatgaccttcttccagaac
tcgcggtaccagacgtaccagcggatgtggaactacatgcaatcgaagcagcccagcgtg
tttgtcaagagcacagaggagggaatcgcccgcgtcctcaactcccgctatgccttcctg
ctggagtccaccatgaacgagtaccacaggcgcctcaattgcaacctcacccagatcggg
ggcctcctcgacaccaagggctacggcatcggcatgccgctgggctcccctttccgggat
gagatcacactggccatcctgcagctccaggagaacaacaggctggagatcctgaagcgc
aagtggtgggagggcggccggtgccccaaggaggaggaccacagggccaaaggtttgggc
atggagaacattggcggcatttttgtcgtgctgatctgtggcctcatcattgctgtcttc
gtggcggtcatggagttcatctggtccacgcggaggtcagcggagtccgaggaggtgtcg
gtgtgccaggagatgctgcaggagctacgccacgccgtgtcttgccgaaagacctcgcgt
tcccgccggcgccggcgccctggtggcccgagccgggccctgctgtcgctgcgcgcagtc
cgcgagatgcgactcagcaacggcaagctctactcggccggcgcgggcggggacgcgggc
gcgcacgggggtccgcagcgcctcctggacgaccccggacctcctgggggaccccggccc
caggctcccacgccctgcacgcacgtgcgcgtctgccaggagtgcaggcgcatccaggcg
ctgcgagcttcgggggccggggcgcccccacgtggcctgggcaccccagccgaagccacc
agcccgcctcggccgcggccaggccccaccggaccccgcgagctgaccgagcacgaatga

DBGET integrated database retrieval system