KEGG   Mus musculus (mouse): 14812Help
Entry
14812             CDS       T01002                                 

Gene name
Grin2b, AW490526, GluN2B, GluRepsilon2, NR2B, Nmdar2b
Definition
(RefSeq) glutamate receptor, ionotropic, NMDA2B (epsilon 2)
  KO
K05210  glutamate receptor ionotropic, NMDA 2B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04724  Glutamatergic synapse
mmu04728  Dopaminergic synapse
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05016  Huntington disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05033  Nicotine addiction
mmu05034  Alcoholism
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14812 (Grin2b)
   04015 Rap1 signaling pathway
    14812 (Grin2b)
   04024 cAMP signaling pathway
    14812 (Grin2b)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14812 (Grin2b)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    14812 (Grin2b)
   04728 Dopaminergic synapse
    14812 (Grin2b)
   04720 Long-term potentiation
    14812 (Grin2b)
  09159 Environmental adaptation
   04713 Circadian entrainment
    14812 (Grin2b)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    14812 (Grin2b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    14812 (Grin2b)
   05014 Amyotrophic lateral sclerosis (ALS)
    14812 (Grin2b)
   05016 Huntington disease
    14812 (Grin2b)
  09165 Substance dependence
   05030 Cocaine addiction
    14812 (Grin2b)
   05031 Amphetamine addiction
    14812 (Grin2b)
   05033 Nicotine addiction
    14812 (Grin2b)
   05034 Alcoholism
    14812 (Grin2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    14812 (Grin2b)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   14812 (Grin2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NMDAR2_C Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Motif
Other DBs
NCBI-GeneID: 14812
NCBI-ProteinID: NP_032197
MGI: 95821
Ensembl: ENSMUSG00000030209
Vega: OTTMUSG00000016356
UniProt: Q01097 G3X9V4
Position
6 G1; 6 66.38 cM
AA seq 1482 aa AA seqDB search
MKPSAECCSPKFWLVLAVLAVSGSKARSQKSAPSIGIAVILVGTSDEVAIKDAHEKDDFH
HLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTL
TPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQ
DFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYI
FEVANSVGLTGYGYTWIVPSLVAGDTDTVPSEFPTGLISVSYDEWDYGLPARVRDGIAII
TTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHP
KLVIILLNKERKWERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVE
SVDPLSGTCMRNTVPCQKRIISENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYL
VTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSR
SNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSF
TIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYV
DQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLS
LKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAI
LQLFGDGEMEELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEH
LFYWQFRHCFMGVCSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILR
LLRTAKNMANLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFS
DYISEVERTFGNLQLKDSNVYQDHYHHHHRPHSIGSTSSIDGLYDCDNPPFTTQPRSISK
KPLDIGLPSSKHSQLSDLYGKFSFKSDRYSGHDDLIRSDVSDISTHTVTYGNIEGNAAKR
RKQQYKDSLKKRPASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRTK
ENSPHWEHVDLTDIYKERSDDFKRDSVSGGGPCTNRSHLKHGTGDKHGVVGGVPAPWEKN
LTNVDWEDRSGGNFCRSCPSKLHNYSSTVAGQNSGRQACIRCEACKKAGNLYDISEDNSL
QELDQPAAPVAVSSNASTTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPR
SVSLKDKGRFMDGSPYAHMFEMPAGESSFANKSSVTTAGHHHNNPGSGYMLSKSLYPDRV
TQNPFIPTFGDDQCLLHGSKSYFFRQPTVAGASKTRPDFRALVTNKPVVSALHGAVPGRF
QKDICIGNQSNPCVPNNKNPRAFNGSSNGHVYEKLSSIESDV
NT seq 4449 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccagcgcagagtgctgttctcccaagttctggttggtgttggccgtcttggcc
gtatcgggcagcaaagctcgttcccaaaagagcgcccccagcatcggcatcgctgtcatc
ctcgtgggcacttccgacgaagtggccataaaagatgcccacgagaaagatgacttccat
catctctcagtagttccccgggtggagctggtagccatgaacgagactgacccaaagagc
ataatcacccgcatctgcgatcttatgtctgaccggaagatccagggggtggtgttcgcg
gatgacacggaccaggaagccatcgcccagatcctcgatttcatttctgctcagactctc
acccccatcctgggcatccatgggggctcatctatgataatggcagataaggatgagtcc
tccatgttcttccagtttggcccatccattgaacagcaagcttctgtcatgctcaacatc
atggaagaatacgactggtacatcttctccatcgtcaccacctacttccccggctaccag
gacttcgtgaacaagatccgcagcactattgagaacagctttgtgggctgggagctcgag
gaagtcctcctgctagacatgtctctagacgatggcgactctaagatccagaatcagctg
aagaagctgcagagccccatcattctcctctactgcacaaaggaagaagccacctacatc
ttcgaagtagctaactcagttgggctgactggctacggctacacatggatcgtgccgagt
ctggtggcgggggatacggacacggtgccttcagagttccccacggggctcatctctgtg
tcatatgacgaatgggactatggccttcctgccagagtgagagatgggattgccatcatc
accactgctgcctcggacatgctgtccgaacacagtttcatccctgagcccaagagcagt
tgctacaacacccacgagaagaggatctaccagtctaacatgctgaataggtatctgatc
aacgtcacttttgaagggagaaacctgtccttcagtgaagatggctaccagatgcatccg
aagctggtgataatccttctgaacaaggagaggaagtgggagagggtgggaaaatggaaa
gacaagtccctgcagatgaaatactatgtgtggcctcgaatgtgtcctgagactgaagaa
caggaagatgaccatctgagcatcgttaccttggaggaggcaccgtttgtcattgtggaa
agtgtggaccctctcagtgggacctgcatgcggaatacagtcccgtgccagaagcgcatc
atctctgagaataaaacagatgaggaaccaggctacatcaaaaaatgctgcaaggggttt
tgtattgatatccttaagaaaatttctaagtctgtgaagttcacctatgacctttacctg
gtgaccaatggcaagcatggaaagaaaatcaacgggacctggaacggcatgattggtgag
gtggtcatgaagagggcctatatggcagtgggatcactaactatcaatgaagaacggtca
gaggtggttgacttctctgtgcccttcatagagactggcatcagtgtcatggtatcacgc
agcaatgggactgtgtcaccttctgccttcttagagccattcagtgctgacgtgtgggtg
atgatgtttgtgatgctgctcattgtctctgctgtagctgtctttgtctttgaatacttc
agccctgtgggttacaaccggtgcctagctgatggcagagagccaggcggcccatctttc
accatcggcaaagcgatttggttactctggggtctggtgtttaacaactccgtacctgtg
cagaacccaaaggggaccacctccaagatcatggtgtcagtgtgggccttctttgctgtc
attttcctggccagctacactgccaacttagccgccttcatgatccaagaggagtatgtg
gaccaggtttccggcctgagtgacaagaagttccagagacctaatgacttctcaccccct
ttccgctttgggactgtgcccaatggcagcacagagaggaatatccgtaataactatgca
gaaatgcatgcctacatgggaaagttcaaccaaaggggtgtagatgatgccttgctctcc
ctgaaaacagggaaacttgatgcattcatctacgatgcagccgtgctcaactacatggct
ggaagagacgaaggctgcaagctggtgaccattggcagtggcaaggtctttgcttctacg
ggctatggcattgctatccaaaaagactctggttggaaacgccaggtggaccttgctatc
ctgcagctgtttggagatggggagatggaagaactggaagctctctggctcactggcatt
tgccacaatgagaagaatgaggttatgagcagccagctggacattgacaacatggcgggc
gtcttctatatgttgggggcagccatggctctcagcctcatcaccttcatctgtgaacat
ctcttctattggcagttccgacattgcttcatgggtgtctgttctggcaagcctggcatg
gtcttctccatcagcagaggtatctacagctgtatccacggagtagctatagaggagcgc
caatccgtgatgaactcccccactgccaccatgaacaacacacactccaatatcctacgc
ttgctccgaacggccaaaaacatggccaacctgtctggagtcaacggctccccccagagt
gccctggacttcatccgccgtgagtcctctgtctatgacatctctgagcatcgccgcagc
ttcacgcattcagactgcaagtcgtacaataacccaccctgtgaggaaaacctgttcagt
gactacattagtgaggtagagagaacatttggcaacctgcagctgaaggacagcaatgtg
taccaagaccactatcaccatcaccaccggccccacagcatcggcagcaccagctccatt
gatgggctctatgactgtgacaacccaccctttaccacccagcccaggtcaatcagcaag
aaacccctggacattggcctgccctcctccaaacacagccagctcagcgacctgtacggc
aagttctctttcaagagtgaccgctacagtggccatgatgacttgattcgatcagatgtc
tcagacatctccacgcatactgtcacctatggcaacatcgagggcaacgcagccaagagg
aggaagcagcaatataaggacagtctaaagaagcggccagcctcggccaaatctaggagg
gagtttgatgaaatcgagctggcctaccgtcgccgaccaccccgctccccagaccacaag
cgctacttcagggacaaagaagggctccgagacttctacctggaccagttccgaacaaag
gagaactcgcctcactgggagcacgtggacttgactgacatttacaaagaacgtagtgat
gacttcaagcgagattcggtcagtggaggcgggccctgtaccaacaggtctcaccttaaa
cacggaacaggcgataagcacggagtggtaggcggggtgcctgctccttgggagaagaac
ctgaccaatgtggattgggaggataggtctgggggcaacttctgccgcagctgtccctcc
aagctgcacaattactcctctacggtggcagggcaaaactcgggccggcaggcctgcatc
aggtgtgaggcctgcaagaaggctggcaacctgtatgacatcagcgaggacaactccctg
caggaactggaccagcctgctgcccctgtggctgtgtcatccaacgcctccaccaccaag
tatcctcaaagcccgactaattccaaggcccagaagaagaatcggaacaaactgcgccgg
cagcactcctacgacaccttcgtggacctgcagaaggaggaggccgccttggccccacgc
agcgtgagcctgaaagacaagggccgattcatggatgggagcccctacgcccatatgttt
gagatgccagctggtgagagctcctttgccaacaagtcctcagtgaccactgccggacac
catcacaacaatcccggcagcggctacatgctcagcaagtcgctctaccctgaccgggtc
acgcaaaaccctttcatccccacttttggggatgatcagtgcttgcttcacggcagcaaa
tcctacttcttcaggcagcccacggtggcaggggcgtcgaaaacaaggccggacttccgg
gcccttgtcaccaataagccagtggtgtcagcccttcatggggctgtgccaggtcgtttc
cagaaggacatttgtatagggaaccagtccaacccctgtgtgcctaacaacaaaaacccc
agggctttcaatggctccagcaatggacatgtttatgagaaactttctagtattgagtct
gatgtctga

DBGET integrated database retrieval system