KEGG   Mus musculus (mouse): 14816
Entry
14816             CDS       T01002                                 

Gene name
Grm1, 4930455H15Rik, Gm10828, Gprc1a, mGluR1, nmf373, rcw, wobl
Definition
(RefSeq) glutamate receptor, metabotropic 1
  KO
K04603  metabotropic glutamate receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04540  Gap junction
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04730  Long-term depression
mmu04742  Taste transduction
mmu04915  Estrogen signaling pathway
mmu05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    14816 (Grm1)
   04020 Calcium signaling pathway
    14816 (Grm1)
   04072 Phospholipase D signaling pathway
    14816 (Grm1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14816 (Grm1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    14816 (Grm1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    14816 (Grm1)
  09156 Nervous system
   04724 Glutamatergic synapse
    14816 (Grm1)
   04720 Long-term potentiation
    14816 (Grm1)
   04730 Long-term depression
    14816 (Grm1)
   04723 Retrograde endocannabinoid signaling
    14816 (Grm1)
  09157 Sensory system
   04742 Taste transduction
    14816 (Grm1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    14816 (Grm1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    14816 (Grm1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14816 (Grm1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     14816 (Grm1)
G protein-coupled receptors [BR:mmu04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   14816 (Grm1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G DUF5438 AAA_34
Other DBs
NCBI-GeneID: 14816
NCBI-ProteinID: NP_058672
MGI: 1351338
Ensembl: ENSMUSG00000019828
Vega: OTTMUSG00000016273
UniProt: P97772 Q3V0U2
Position
10; 10 A1
AA seq 1199 aa
MVRLLLIFFPMIFLEMSILPRMPDRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
EFIRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAM
AHGLQNMHHALCPGYVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYD
IMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGMVRSVCSEPCLKGQIKVIRKGE
VSCCWICTACKENEFVQDEFTCRACDLGWWPNAELTGCEPITIRYLEWSDIESIIAIAFS
CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQ
RLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTL
VVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPVGYNGLLIMSCTYYAFKTRNVPAN
FNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKPGAGNANSNGKSVSWSEPGG
RQAPKGQHVWQRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDASTKTLYNVEEE
DNTPSTHFSPPSSPSMVVHRRGPPVATTPPLPPHLSAEETPLFLADSVIPKGLPPPLPQQ
QQQPPPQPPPQQPKSLMDQLQGVVTNFGSGIPDFHAVLAGPGTPGNGLRSLYPPPPPPQH
LQMLPLQLSTFREEPISPPGEDDDDDSSERFKLLQEFVYEREGNTEEDDLEEEEDLPAAS
KLTPEDSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVTYASVILRDYKQSSSTL
NT seq 3600 nt   +upstreamnt  +downstreamnt
atggtccggctcctcttgattttcttcccaatgatctttttggagatgtccattttgccc
aggatgcctgacagaaaagtactgctggcaggtgcctcgtcccagcgctctgtggcgaga
atggacggagatgtcatcatcggagccctcttctcagtccatcaccagcctccagccgaa
aaggtaccggaaaggaagtgtggggagatcagagaacagtatggtatccagagagtggag
gccatgttccacacattagataagattaatgcggacccggtgctcctgcccaacatcact
ctgggcagtgagatccgggactcctgctggcactcttctgtggctctggaacagagcatt
gagttcatcagagactccctgatttccatccgagatgagaaggatggactgaaccgctgc
ctgcctgatggccagaccctacccccaggcaggactaagaagcctattgctggagtgatc
ggccctggctccagctctgtggccattcaagtccagaatcttctgcagctgttcgacatc
ccacaaatcgcctattctgccacgagcatagacctgagcgacaaaactttgtacaaatac
ttcctgagggtggtcccttctgacactttgcaggcaagggcgatgcttgatatcgtcaag
cggtacaactggacctatgtctctgcagtccacacagaagggaattacggcgagagtgga
atggatgctttcaaagagttggctgcccaggaaggactctgcatcgcacactcggacaaa
atctacagcaatgctggcgagaagagctttgatcggcttctgcgcaagctccgagagcgg
cttcccaaggccagggttgtggtctgcttctgcgagggcatgacagtgcgggggttactg
agtgccatgcgccgccttggcgtcgtgggagagttctcactcattggaagtgatggatgg
gcagacagagatgaagtcatcgaaggctatgaggtggaagccaatgggggaatcacaata
aagctgcagtctccagaggtcaggtcgtttgatgactactttctgaagctgaggctggac
accaacacgaggaatccttggttccctgagttctggcaacatcgcttccagtgtcgccta
cctggacacctcttggaaaaccccaactttaaaaaagtctgcacaggaaatgaaagcttg
gaagaaaattatgtccaggacagcaaaatgggatttgtcatcaacgccatctatgccatg
gcacacggcctacagaacatgcaccatgctctatgtcctggctacgtgggcctttgtgat
gccatgaagcccattgacggcaggaagctcctggatttcctcatcaaatcctcttttgtt
ggagtgtctggagaggaggtctggttcgatgagaagggggatgcacctggaaggtatgac
attatgaatctgcagtacacagaggctaatcgctatgactatgtccatgtgggaacctgg
catgaaggtgtgctgaatatcgatgattacaaaatccagatgaacaaaagcggaatggta
cgatctgtgtgcagcgagccttgcttaaagggtcagattaaggtcatacggaaaggggaa
gtgagctgctgctggatctgcacagcctgcaaagagaatgagtttgtgcaagatgagttt
acctgcagagcctgtgacctggggtggtggcccaatgcagagctcacaggctgtgagccc
attactatccgttacctcgagtggagtgacatagaatccatcatagccatcgccttttct
tgcctgggcatcctcgtgacgctatttgtcaccctcatctttgtgctgtaccgggacaca
cctgtggtcaaatcctccagtagagagctctgctatatcattctggctggtattttcctc
ggctacgtatgccctttcaccctcatcgccaaacctactaccacatcctgctacctccag
cgcctcctagttggcctctcttctgccatgtgctactctgctcttgtgaccaaaaccaat
cgtattgcacgcatcctggctggcagcaagaagaagatctgtacccggaagcccaggttc
atgagcgcttgggcccaagtgatcatagcctccattctgattagtgtacagctgacacta
gtggtgaccttgatcatcatggagcctcccatgcccattttgtcctacccgagcatcaag
gaagtctatcttatctgcaataccagcaacctgggtgtagtggcacctgtgggttacaac
ggacttctcatcatgagctgtacctactatgccttcaagacccgcaacgtgccggccaat
ttcaatgaggctaaatacatcgccttcactatgtacaccacctgcatcatctggctggct
tttgttcccatttactttgggagcaactacaagattatcactacctgcttcgcagtgagc
ctcagtgtgacggtggccctgggctgcatgttcactcccaagatgtacatcattattgcc
aaacccgagaggaatgtccgcagtgccttcaccacctctgatgtagtgcgcatgcacgtc
ggtgacggcaagctgccatgccgctccaacaccttcctcaacattttccggagaaagaag
cctggggcagggaacgccaattctaacggcaagtctgtgtcatggtctgaaccaggtgga
agacaggcgcccaagggacagcatgtgtggcagcgcctctctgtgcacgtgaagaccaat
gagacggcctgtaaccaaacagccgtaattaaacccctcactaaaagttaccaaggctct
ggcaagagtctgaccttttcagacgccagcaccaagaccctttacaacgtggaggaagag
gacaataccccttcaactcacttcagccctcccagcagcccttccatggtggtgcaccga
cgcgggccacccgtggccaccacgccacctctgccaccccaccttagcgcagaagagacg
cccttgttcctggctgattctgtcatccccaagggcttgcctcctcctctcccgcagcag
caacagcagccgccccctcagccgcctccgcagcagcccaaatccctgatggaccagctg
caaggcgtggtcaccaactttggctctgggattccagacttccacgcggtgctggcaggc
ccggggacaccagggaacgggctgcgctccctgtacccgcccccgcctccaccgcaacac
ctgcagatgttgcccctgcagctgagcaccttccgagaggagcccatctcccctccgggg
gaggacgacgatgatgacagcagcgagaggttcaagctcctgcaggagttcgtgtatgag
cgtgaagggaacacggaggaagacgatctggaagaggaggaggacctgcctgcagccagc
aagctgacgcctgaggattcgcctgccctgacgcccccttctcctttccgagattccgtg
gcctctggcagctcagtgcccagttccccagtgtctgagtcagtgctctgcacccctcca
aatgtgacctatgcctctgtcattctgagggactacaagcaaagctcttccactctgtag

DBGET integrated database retrieval system