KEGG   Mus musculus (mouse): 14827
Entry
14827             CDS       T01002                                 

Gene name
Pdia3, 58kDa, E, ERp57, ERp60, ERp61, Erp, Grp, Grp58, P, PDI, PDI-, PDI-Q2, PI-PLC, PLC[a], Plca
Definition
(RefSeq) protein disulfide isomerase associated 3
  KO
K08056  protein disulfide-isomerase A3 [EC:5.3.4.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04612  Antigen processing and presentation
mmu05163  Human cytomegalovirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    14827 (Pdia3)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    14827 (Pdia3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    14827 (Pdia3)
   05168 Herpes simplex virus 1 infection
    14827 (Pdia3)
   05163 Human cytomegalovirus infection
    14827 (Pdia3)
   05169 Epstein-Barr virus infection
    14827 (Pdia3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    14827 (Pdia3)
   04131 Membrane trafficking [BR:mmu04131]
    14827 (Pdia3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14827 (Pdia3)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     14827 (Pdia3)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Protein disulfide isomerase
   14827 (Pdia3)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    14827 (Pdia3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   14827 (Pdia3)
  Exosomal proteins of colorectal cancer cells
   14827 (Pdia3)
  Exosomal proteins of bladder cancer cells
   14827 (Pdia3)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 Thioredoxin_4 OST3_OST6 AhpC-TSA Thioredoxin_3
Other DBs
NCBI-GeneID: 14827
NCBI-ProteinID: NP_031978
MGI: 95834
Ensembl: ENSMUSG00000027248
Vega: OTTMUSG00000015325
UniProt: P27773
Position
2 E5; 2 60.38 cM
AA seq 505 aa
MRFSCLALLPGVALLLASARLAAASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRD
NYRFAHTNIESLVKEYDDNGEGITIFRPLHLANKFEDKTVAYTEKKMTSGKIKKFIQDSI
FGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFA
VASRKTFSHELSDFGLESTTGEVPVVAIRTAKGEKFVMQEEFSRDGKALEQFLQEYFDGN
LKRYLKSEPIPESNEGPVKVVVAENFDDIVNEEDKDVLIEFYAPWCGHCKNLEPKYKELG
EKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYL
QREATNPPIIQEEKPKKKKKAQEDL
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgcgcttcagctgcctagctctgctcccgggcgtggcgctgctgctcgcctcggcccgt
ctcgccgccgcctccgatgtgttggaactgacggacgaaaacttcgagagtcgcgtctcc
gacacgggctcggcggggctcatgctagtcgagttcttcgccccctggtgtggacattgc
aagaggcttgcccctgagtatgaagctgcagcaaccagattaaaaggaatagtcccatta
gcaaaggtggattgcactgccaacacaaacacctgtaataagtatggggtcagtggctac
ccaactcttaagatctttagagatggtgaagaagcgggtgcttatgatgggcctaggact
gctgatggaattgtcagccacttgaagaaacaagcaggaccagcttcagttcctctcagg
actgaggaagaatttaagaagttcattagtgataaagatgcctcagtggtgggttttttc
agggatttattcagtgatgggcactctgaattcctaaaagcagccagcaacttgagagat
aactaccgatttgcacacaccaacattgagtctctggtgaaggagtacgatgataatgga
gaggggatcactatattccgtccattacatcttgctaacaagtttgaagacaaaactgtg
gcatatactgaaaagaaaatgaccagtggcaagatcaagaaatttattcaggatagcatt
tttggtctctgtcctcatatgacggaagataataaagatttgatacaaggcaaggactta
ctcaccgcttactatgatgtggactatgaaaagaatgctaaaggttctaactactggaga
aacagggtcatgatggtggcaaagaaattccttgatgctggacacaaactcaactttgct
gtagctagccgtaaaacctttagccatgaactgtcagattttggcttagaaagcactact
ggagaggttcctgttgtggctatcagaactgctaaaggagagaagtttgtcatgcaggag
gagttctcgcgagatggcaaggctcttgaacagttcctgcaagaatactttgatggcaac
ttgaagagatacctgaagtctgaacccatcccagagtccaacgaagggcctgtcaaggtt
gtggtagcagagaattttgatgacatagtgaatgaagaagataaggacgtgctgattgaa
ttttacgccccttggtgtggccactgtaagaatctggaacccaagtataaagagctggga
gaaaaactcagcaaagatccaaatattgtcatagccaagatggatgccacagccaatgat
gtgccttctccatatgaagtcaagggttttcctaccatctacttctcaccagccaacaag
aagctaactccaaagaagtatgaaggtggccgtgaattaaatgattttattagctatcta
caacgagaagctacaaacccccctataattcaagaagaaaaacctaagaagaagaagaag
gcacaagaggacctctaa

DBGET integrated database retrieval system