KEGG   Mus musculus (mouse): 14828Help
Entry
14828             CDS       T01002                                 

Gene name
Hspa5, AL022860, AU019543, Bip, D2Wsu141e, D2Wsu17e, Grp78, Hsce70, SEZ-7, Sez7, baffled, mBiP
Definition
(RefSeq) heat shock protein 5
  KO
K09490  heat shock 70kDa protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03060  Protein export
mmu04141  Protein processing in endoplasmic reticulum
mmu04612  Antigen processing and presentation
mmu04918  Thyroid hormone synthesis
mmu05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    14828 (Hspa5)
   04141 Protein processing in endoplasmic reticulum
    14828 (Hspa5)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    14828 (Hspa5)
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    14828 (Hspa5)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05020 Prion diseases
    14828 (Hspa5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    14828 (Hspa5)
   04131 Membrane trafficking [BR:mmu04131]
    14828 (Hspa5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14828 (Hspa5)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP70 / DNAK
   14828 (Hspa5)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    14828 (Hspa5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   14828 (Hspa5)
  Exosomal proteins of other body fluids (saliva and urine)
   14828 (Hspa5)
  Exosomal proteins of colorectal cancer cells
   14828 (Hspa5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA DUF4624 Hydantoinase_A DDR FGGY_C DUF4795
Motif
Other DBs
NCBI-GeneID: 14828
NCBI-ProteinID: NP_001156906
MGI: 95835
Ensembl: ENSMUSG00000026864
Vega: OTTMUSG00000012014
UniProt: P20029
Position
2 B; 2 22.94 cM
AA seq 655 aa AA seqDB search
MMKFTVVAAALLLLGAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGN
RITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKV
VEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDA
QRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDN
GVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRAL
SSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEI
VLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDV
CPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLL
GTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIE
RMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVE
EKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSGGPPPTGEEDTSEKDEL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagttcactgtggtggcggcggcgttgctgctgctgggcgcggtgcgggccgag
gaggaggacaagaaggaggatgtgggcacggtggtcggcatcgacttggggaccacctat
tcctgcgtcggtgtgttcaagaacggccgcgtggagatcatagccaacgatcagggcaac
cgcatcacgccgtcgtatgtggccttcactcctgaaggggagcgtctgattggcgatgcg
gccaagaaccaactcacgtccaaccccgagaacacggtcttcgatgccaagcgcctcatc
ggacgcacttggaatgacccttcggtgcagcaggacatcaagttcttgccattcaaggtg
gttgaaaagaaaactaaaccgtacattcaagttgatattggaggtgggcaaaccaagaca
tttgccccagaagaaatttctgccatggttctcactaaaatgaaggagactgctgaggcg
tatttgggaaagaaggttacccatgcagttgttactgtaccagcttacttcaatgatgcc
cagcgacaagcaaccaaagatgctggcactattgctggactgaatgtcatgaggatcatc
aatgagcctacagcagctgctattgcatatggcctggataagagagagggagagaagaac
atccttgtgtttgacctgggtggcggcaccttcgatgtgtctcttctcaccattgacaat
ggtgtctttgaagtggtggccactaatggagatactcacctgggtggggaagactttgat
cagcgggtcatggaacacttcatcaagttgtacaaaaagaaaactggtaaagatgttagg
aaagacaacagagctgtgcagaaactccggcgtgaggtagaaaaggctaagagagccttg
tcttctcagcatcaagcaaggattgaaattgagtccttcttcgaaggagaagacttctca
gagacccttactcgggccaaatttgaagagctgaacatggacctgttccgctctaccatg
aagcctgtccagaaagtgttggaagactctgatctgaagaaatctgatattgatgaaatt
gttctggttggtggatctactcgaattccaaagattcagcaactggtgaaagagttcttc
aatggcaaggagccatcccgtggcataaaccccgatgaggctgtagcctatggtgccgct
gtccaggctggtgtcctctctggtgatcaggatacaggtgatctggtactgcttgatgtt
tgtccccttacacttggtattgaaactgtgggaggagtcatgacaaaactgattccaagg
aacactgtggtacccaccaagaagtctcagatcttctccacggcttccgataatcagcca
actgtaacaatcaaggtctatgaaggtgaacgacccctaacaaaagacaatcatcttctg
ggtacatttgatctgactggaattcctcctgctccccgtggagttccccagattgaagtc
acttttgagatagatgttaatggtattctccgagtgacagctgaagacaaaggtacagga
aacaaaaacaaaatcacaattaccaatgaccaaaaccgcctgacacctgaagaaattgaa
aggatggttaatgatgctgagaagtttgctgaggaagacaaaaagctcaaagagcgcatt
gacaccaggaatgaattggaaagctatgcttattctctcaagaaccagattggagataaa
gaaaagctgggaggtaaactttcttctgaagataaagaaaccatggaaaaagctgtagag
gaaaagattgaatggctggaaagccaccaggatgcggacattgaagactttaaagccaaa
aagaaggaactagaagaaattgttcagccaattatcagcaaactctatggaagtggaggc
cctcccccaactggtgaagaggatacatcagaaaaagatgagttgtag

DBGET integrated database retrieval system