KEGG   Mus musculus (mouse): 14842Help
Entry
14842             CDS       T01002                                 

Gene name
Gsx1, Gsh-1, Gsh1
Definition
(RefSeq) GS homeobox 1
  KO
K09310  homeobox protein GSH
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14842 (Gsx1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    14842 (Gsx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN Terminase_5
Motif
Other DBs
NCBI-GeneID: 14842
NCBI-ProteinID: NP_032204
MGI: 95842
Ensembl: ENSMUSG00000053129
Vega: OTTMUSG00000024587
UniProt: P31315 B2RQ55
Position
5 G3; 5 86.79 cM
AA seq 261 aa AA seqDB search
MPRSFLVDSLVLREASDKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPL
CVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSVSPGVAHGPAAAAAAAALYQ
TSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIA
TYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGAGAGAGGGAPQGCKCSSLSSAKCSEDD
DELPMSPSSSGKDDRDLTVTP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctccttcctggtggattcccttgtgctgcgggaagccagcgacaagaaggct
ccggagggcagcccgccaccgctcttcccctacgcggtcccgccgccgcacgcgctccac
ggcctctcgccgggcgcctgccacgcgcgcaaggccggcttgctgtgcgtgtgtcccctc
tgtgtcaccgcttcgcagctgcacgggccccccgggccgccggcactgccgctactcaag
gcgtccttccctcccttcggatcgcagtactgccacgcacccctgggccgccagcactcc
gtgtcccctggagtcgcccacggcccggctgcggccgcagcagctgctgcactctaccag
acctcctacccgctgccggatcccagacagtttcactgcatctctgtggacagcagctcg
aaccagctgcccagcagcaagaggatgcggacggcgttcaccagcacacagctcctggag
ctggagcgagagttcgcctccaacatgtacctctcccgcctgcggcgcatcgagatcgcg
acctatctgaacctgtccgagaagcaggtgaagatctggtttcagaaccgccgggtgaag
cacaagaaagaaggcaaaggcagtaaccaccgcggcggagctggggcgggggccggcggg
ggcgcaccgcaaggctgcaagtgctcttcgctctcctcagccaaatgctcagaggacgac
gacgaattgcccatgtctccatcttcctccgggaaggatgacagagatctcacagtcact
ccgtag

DBGET integrated database retrieval system