KEGG   Mus musculus (mouse): 14852Help
Entry
14852             CDS       T01002                                 

Gene name
Gspt1, AI314175, AI326449, AV307676, C79774, G1st, Gst-1
Definition
(RefSeq) G1 to S phase transition 1
  KO
K03267  peptide chain release factor subunit 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    14852 (Gspt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    14852 (Gspt1)
   03012 Translation factors [BR:mmu03012]
    14852 (Gspt1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     14852 (Gspt1)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Release factors
   14852 (Gspt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 PAM2 MMR_HSR1 LPD34
Motif
Other DBs
NCBI-GeneID: 14852
NCBI-ProteinID: NP_666178
MGI: 1316728
Ensembl: ENSMUSG00000062203
Vega: OTTMUSG00000035233
UniProt: Q8R050
Structure
PDB: 

Position
16 A1; 16 6.38 cM
AA seq 636 aa AA seqDB search
MDPSSGGGGGGGGGGSSSSSDSAPDCWDQTDMEAPGPGPCGGGGSGSGSMAAVAEAQREN
LSAAFSRQLNVNAKPFVPNVHAAEFVPSFLRGPAQPPLSPAGAAGGDHGAGSGAGGPSEP
VESSQDQSCEGSNSTVSMELSEPVVENGETEMSPEESWEHKEEISEAEPGGGSSGDGRPP
EESTQEMMEEEEEIPKPKSAVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDK
RTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHK
SFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMD
DPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLP
FIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEV
LGILSDDVETDSVAPGENLKIRLKGIEEEEILPGFILCDLNNLCHSGRTFDAQIVIIEHK
SIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTI
CLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggatcctagcagcggcggtggcggcggtggcggcggcggcgggagcagcagcagcagc
gactctgcgcccgactgctgggaccagacggatatggaggcccccgggcccgggccttgc
ggcggcggcgggagcggcagcggctccatggccgcggtggccgaggcccagcgtgagaac
ctcagcgcggctttcagccggcaactcaacgtcaacgccaagcctttcgtccccaacgtc
cacgccgctgaattcgtgccgtccttcctgcggggtccggcccagccgccgctatcccca
gctggcgcagccggaggcgaccacggagcaggcagcggcgcgggaggcccttcggaacct
gtagagtcctctcaagaccagtcgtgtgaaggttcaaattctactgttagcatggaactt
tcagaacctgttgtagaaaatggagagacagaaatgtccccagaagaatcatgggagcac
aaagaagaaataagtgaagcggagccagggggtggttcctcaggagatggaaggccacca
gaggaaagcacccaagaaatgatggaggaggaggaagaaataccgaaacctaagtcagcg
gtggcaccaccaggtgctcccaagaaggaacatgtaaatgtagtgttcatcggacatgtt
gatgcaggcaagtcaaccattggaggacaaataatgtatttgactggaatggtcgacaaa
aggacacttgagaagtatgaacgagaagctaaagaaaaaaacagagaaacttggtacttg
tcttgggccttagacacgaatcaggaagaacgagacaagggcaaaaccgtggaggtgggt
cgtgcctattttgaaacggaaaagaagcattttacaattctagatgctcctggccataag
agttttgtcccaaatatgattggtggtgcctctcaagctgacttggctgtactggtaatc
tcagccaggaaaggagagtttgaaactggatttgaaaaaggaggacagacaagagaacat
gcaatgttggcaaagacagcaggtgtcaaacacttaattgtgcttattaataagatggat
gatccaacggtaaactggagcaacgagagatatgaagaatgtaaagagaaactagtacca
tttttgaaaaaagttggcttcaatcccaaaaaggacattcattttatgccgtgctcagga
ctgacaggagcgaatcttaaagaacaatcagatttctgtccttggtacattggcttacca
tttattccatatctggataatttgccaaacttcaatagatcagttgatggaccaatcagg
ctgccaattgtcgataagtacaaggatatggggactgtggtcctgggaaagctggaatct
ggatctatttgtaaaggccagcagcttgtaatgatgccaaataagcacaacgtggaagtt
cttggaatactttctgatgatgtagaaacggactctgtagctccaggtgaaaacctcaaa
atcagactgaaaggaattgaagaggaagagattcttccaggattcatcctttgtgatctt
aataatctttgtcattctggacgcacatttgatgctcagatagtgattatagagcacaag
tccatcatctgcccagggtataatgcggtgctgcatattcatacctgtatcgaagaagtc
gaaataacagccttaatctgcttggtagacaagaaatcaggagagaaaagtaagactcga
ccccgttttgtaaaacaagatcaagtatgcattgcgcgtttaaggacagcaggaaccatc
tgcctggagacctttaaggacttccctcagatgggacgttttaccttaagagatgagggt
aagaccattgcaattggaaaagttctgaaactggttccagagaaagactaa

DBGET integrated database retrieval system