KEGG   Mus musculus (mouse): 14853
Entry
14853             CDS       T01002                                 

Symbol
Gspt2
Name
(RefSeq) G1 to S phase transition 2
  KO
K03267  peptide chain release factor subunit 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    14853 (Gspt2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    14853 (Gspt2)
   03012 Translation factors [BR:mmu03012]
    14853 (Gspt2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     14853 (Gspt2)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Release factors
   14853 (Gspt2)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 PAM2 MMR_HSR1
Other DBs
NCBI-GeneID: 14853
NCBI-ProteinID: NP_032205
MGI: 1316727
Ensembl: ENSMUSG00000071723
Vega: OTTMUSG00000018134
UniProt: Q149F3
Position
X; X C3
AA seq 632 aa
MDLGSSSDSAPDCWDQVDMEAPGSAPSGDGIAPAAMAAAEAAEAEAQRKHLSLAFSSQLN
IHAKPFVPSVSAAEFVPSFLPGSAQPPAPTASSCDETCIGGAGEPEGKRMEWGAPVEPSK
DGPLVSWEGSSSVVTMELSEPVVENGEVEMALEESWELKEVSEAKPEASLGDAGPPEESV
KEVMEEKEEVRKSKSVSIPSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDRRTLE
KYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVP
NMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKYLIVLINKMDDPTV
DWSSERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTGANIKEQSDFCPWYTGLPFIPY
LDSLPNFNRSIDGPIRLPIVDKYKDMGTVVLGKLESGSIFKGQQLVMMPNKHSVEVLGIV
SDDAETDFVAPGENLKIRLKGIEEEEILPGFILCEPSNLCHSGRTFDVQIVIIEHKSIIC
PGYNAVLHIHTCIEEVEITALISLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLET
FKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD
NT seq 1899 nt   +upstreamnt  +downstreamnt
atggatctcggcagcagcagcgactcggctcccgactgctgggatcaggtggacatggaa
gccccgggttcggctccgagcggggatggaatcgcccccgcagccatggcagcggctgag
gccgcggaagccgaggcccagcgcaagcatctcagcttggccttcagcagtcagctcaac
atccacgccaaacctttcgtgcctagcgtaagcgcagcggagttcgtgccgtccttcctg
cctggatcggcccagccgcccgcccccacagcctccagctgcgacgaaacctgcatcggt
ggcgccggggagcctgaaggtaaacggatggaatggggagcacctgtagaaccttccaaa
gatggccctttagtgtcgtgggagggttccagttcagttgttaccatggaactttcagaa
cctgttgtagaaaatggagaggtggagatggccctagaagaatcttgggagcttaaagaa
gtgagtgaagcaaagcctgaggcttctttgggagatgcagggcccccagaagaaagtgtc
aaggaagtgatggaggagaaagaggaagtaaggaaatcaaaatctgtgtccataccatca
ggtgcacctaagaaagaacacgtaaatgtggtcttcattgggcatgtggatgctggcaag
tcaaccattggaggacaaataatgtttttgacaggaatggttgacagaaggacacttgag
aaatacgaacgagaagctaaggagaagaatagagagacctggtacttgtcctgggcctta
gatacaaaccaggaagaacgagacaagggtaaaacagtggaagtgggccgtgcgtatttt
gaaacggaaaagaagcatttcacaatcctagatgcccctggccacaagagttttgtccca
aatatgattggcggtgcctctcaagccgatttagctgtgctggtgatctctgccaggaaa
ggggaatttgagactggatttgaaaaaggtggacagacaagagaacatgcaatgctggcc
aaaacagcaggggtaaaatacttaatagtgcttattaataagatggatgaccccacagta
gattggagcagtgagcgatatgaagaatgtaaagaaaaactggtgccctttttgaaaaaa
gttggtttcagtccaaaaaaggacattcactttatgccctgctcaggactgactggagca
aatattaaagagcaatctgatttctgtccttggtacaccggattaccatttattccgtat
ttggatagtttgccaaacttcaacagatcaattgatgggccaattaggttgccaattgtg
gataagtacaaggatatgggcactgtggtcctgggtaagctggaatcaggatccattttt
aaaggccagcagcttgtgatgatgccaaacaagcacagtgtggaagttctaggaatcgtt
tctgatgatgccgagactgattttgtagctccaggtgaaaacctcaaaatcagactgaaa
gggattgaagaggaagagattcttccaggcttcatactttgtgaacccagtaatctttgc
cattccggacgcacatttgatgttcagatagtgatcattgagcacaagtctatcatctgc
ccaggttataatgcggtgcttcacattcatacttgtattgaggaggttgaaataacagcc
ttgatctccttagtagacaaaaagtcaggagaaaaaagcaagacacggccccgctttgtg
aagcaagaccaagtgtgcattgcccggttaaggacagcaggaactatctgcctggagaca
tttaaagattttcctcagatgggtcgttttactttaagagatgagggtaaaacaatcgcc
attggaaaagttctgaagctggtcccagagaaggactaa

DBGET integrated database retrieval system