KEGG   Mus musculus (mouse): 14862
Entry
14862             CDS       T01002                                 

Gene name
Gstm1, Gstb-1, Gstb1
Definition
(RefSeq) glutathione S-transferase, mu 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14862 (Gstm1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14862 (Gstm1)
   00982 Drug metabolism - cytochrome P450
    14862 (Gstm1)
   00983 Drug metabolism - other enzymes
    14862 (Gstm1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14862 (Gstm1)
   05204 Chemical carcinogenesis
    14862 (Gstm1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14862 (Gstm1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14862 (Gstm1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14862 (Gstm1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14862 (Gstm1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14862 (Gstm1)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14862 (Gstm1)
SSDB
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_2 GST_C_6 GST_N_3 GST_N_4
Other DBs
NCBI-GeneID: 14862
NCBI-ProteinID: NP_034488
MGI: 95860
Ensembl: ENSMUSG00000058135
Vega: OTTMUSG00000007188
UniProt: P10649
Position
3; 3 F2.3
AA seq 218 aa
MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNL
PYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDF
EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPN
LRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcctatgatactgggatactggaacgtccgcggactgacacacccgatccgcatgctc
ctggaatacacagactcaagctatgatgagaagagatacaccatgggtgacgctcccgac
tttgacagaagccagtggctgaatgagaagttcaagctgggcctggactttcccaatctg
ccttacttgatcgatggatcacacaagatcacccagagcaatgccatcctgcgctacctt
gcccgaaagcaccacctggatggagagacagaggaggagaggatccgtgcagacattgtg
gagaaccaggtcatggacacccgcatgcagctcatcatgctctgttacaaccctgacttt
gagaagcagaagccagagttcttgaagaccatccctgagaaaatgaagctctactctgag
ttcctgggcaagaggccatggtttgcaggggacaaggtcacctatgtggatttccttgct
tatgacattcttgaccagtaccgtatgtttgagcccaagtgcctggacgccttcccaaac
ctgagggacttcctggcccgcttcgagggcctcaagaagatctctgcctacatgaagagt
agccgctacatcgcaacacctatattttcaaagatggcccactggagtaacaagtag

DBGET integrated database retrieval system