KEGG   Mus musculus (mouse): 14869
Entry
14869             CDS       T01002                                 

Gene name
Gstp2, GS, GSTpiA, Gst, Gst-, Gst-3, Gst3
Definition
(RefSeq) glutathione S-transferase, pi 2
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05215  Prostate cancer
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14869 (Gstp2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14869 (Gstp2)
   00982 Drug metabolism - cytochrome P450
    14869 (Gstp2)
   00983 Drug metabolism - other enzymes
    14869 (Gstp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14869 (Gstp2)
   05204 Chemical carcinogenesis
    14869 (Gstp2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14869 (Gstp2)
   05215 Prostate cancer
    14869 (Gstp2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14869 (Gstp2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14869 (Gstp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14869 (Gstp2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14869 (Gstp2)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14869 (Gstp2)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Other DBs
NCBI-GeneID: 14869
NCBI-ProteinID: NP_861461
MGI: 95864
Ensembl: ENSMUSG00000038155
Vega: OTTMUSG00000046063
UniProt: P46425
Position
19 A; 19 3.75 cM
AA seq 210 aa
MPPYTIVYFPSPGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGD
LTLYQSNAILRHLGRSLGLYGKNQREAAQVDMVNDGVEDLRGKYGTMIYRNYENGKNDYV
KALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLLSAY
VARLSARPKIKAFLSSPEHVNRPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccgccgtacaccattgtctacttcccaagtccagggcggtgtgaggccatgcgcatg
ctgctggctgaccagggccagagctggaaggaggaggtggttaccatagatacctggatg
caaggcttgctcaagcccacttgtctgtatgggcagctccccaagtttgaggatggagac
ctcaccctttaccaatctaatgccatcttgagacaccttggccgctctttggggctttat
gggaaaaaccagagggaggccgcccaggtggatatggtgaatgatggggtggaggacctt
cgcggcaaatatggcaccatgatctacagaaactatgagaatggtaagaatgactacgtg
aaggccctgcctgggcatctgaagccttttgagaccctgctgtcccagaaccagggaggc
aaagctttcatcgtgggtgaccagatctcctttgccgattacaacttgctggacctgctg
ctgatccaccaagtcctggcccctggctgcctggacaacttccccctgctctctgcctat
gtggctcgcctcagtgcccggcccaagatcaaggcctttctgtcctccccggaacatgtg
aaccgtcccatcaatggcaatggcaaacagtag

KEGG   Mus musculus (mouse): 14870
Entry
14870             CDS       T01002                                 

Gene name
Gstp1, Gst, GstpiB
Definition
(RefSeq) glutathione S-transferase, pi 1
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05215  Prostate cancer
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14870 (Gstp1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14870 (Gstp1)
   00982 Drug metabolism - cytochrome P450
    14870 (Gstp1)
   00983 Drug metabolism - other enzymes
    14870 (Gstp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14870 (Gstp1)
   05204 Chemical carcinogenesis
    14870 (Gstp1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14870 (Gstp1)
   05215 Prostate cancer
    14870 (Gstp1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14870 (Gstp1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14870 (Gstp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14870 (Gstp1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14870 (Gstp1)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14870 (Gstp1)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Other DBs
NCBI-GeneID: 14870
NCBI-ProteinID: NP_038569
MGI: 95865
Ensembl: ENSMUSG00000060803
Vega: OTTMUSG00000046062
UniProt: P19157
Structure
PDB: 

Position
19 A; 19 3.75 cM
AA seq 210 aa
MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGD
LTLYQSNAILRHLGRSLGLYGKNQREAAQMDMVNDGVEDLRGKYVTLIYTNYENGKNDYV
KALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLLSAY
VARLSARPKIKAFLSSPEHVNRPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccaccatacaccattgtctacttcccagttcgagggcggtgtgaggccatgcgaatg
ctgctggctgaccagggccagagctggaaggaggaggtggttaccatagatacctggatg
caaggcttgctcaagcccacttgtctgtatgggcagctccccaagtttgaggatggagac
ctcaccctttaccaatctaatgccatcttgagacaccttggccgctctttggggctttat
gggaaaaaccagagggaggccgcccagatggatatggtgaatgatggggtggaggacctt
cgcggcaaatatgtcaccctcatctacaccaactatgagaatggtaagaatgactacgtg
aaggccctgcctgggcatctgaagccttttgagaccctgctgtcccagaaccagggaggc
aaagctttcatcgtgggtgaccagatctcctttgccgattacaacttgctggacctgctg
ctgatccaccaagtcctggcccctggctgcctggacaacttccccctgctctctgcctat
gtggctcgcctcagtgcccggcccaagatcaaggcctttctgtcctccccggaacatgtg
aaccgtcccatcaatggcaatggcaaacagtag

KEGG   Mus musculus (mouse): 225884
Entry
225884            CDS       T01002                                 

Gene name
Gstp3
Definition
(RefSeq) glutathione S-transferase pi 3
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05215  Prostate cancer
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    225884 (Gstp3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    225884 (Gstp3)
   00982 Drug metabolism - cytochrome P450
    225884 (Gstp3)
   00983 Drug metabolism - other enzymes
    225884 (Gstp3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    225884 (Gstp3)
   05204 Chemical carcinogenesis
    225884 (Gstp3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    225884 (Gstp3)
   05215 Prostate cancer
    225884 (Gstp3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    225884 (Gstp3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    225884 (Gstp3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    225884 (Gstp3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     225884 (Gstp3)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   225884 (Gstp3)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Other DBs
NCBI-GeneID: 225884
NCBI-ProteinID: NP_001348972
MGI: 2385078
Ensembl: ENSMUSG00000058216
Vega: OTTMUSG00000046064
Position
19; 19 A
AA seq 193 aa
MRMLLADQGQSWKEEVVTLDVWEQGTFKASCLFGQIPKFQDGELTLYQSNTILRHLGRSF
GLYGKDQQEAALVDMVNDGLEDLFRRIARQYRHILKEGKDQYQKELPGHLKPFETLLAQN
RGGQSFIVGDQISFADYRLLDVLLNLELLFPGYLNDFPLFSAYVARLKSRPKLKAFLESP
EHVNRPLAACIKM
NT seq 582 nt   +upstreamnt  +downstreamnt
atgcgcatgcttctagctgaccagggccagagctggaaggaggaggtggtgaccttggat
gtttgggagcaaggcacattcaaggcttcctgtttgtttggacagatccccaagttccag
gatggagagctcaccctgtaccaatccaatactatcctacggcacctgggccgctccttc
gggctctatggcaaagaccaacaagaggcagcactggtggacatggtgaacgatggactg
gaagacctattcagacgcattgcccggcagtatcgccatatcctgaaggagggcaaggac
cagtatcagaaggagcttccgggacacctgaagccatttgaaactctcctggcccagaac
aggggtggccagtccttcattgttggtgaccagatctctttcgcggactaccgcctgctg
gacgtgcttctgaatctcgagctcctgtttcctggttacttgaatgactttcccctgttc
tccgcctatgtggcgcgcctcaaatcccgacccaagctcaaggccttcctggagtctcct
gagcatgtgaaccggcccctggctgcttgcataaagatgtga

DBGET integrated database retrieval system