KEGG   Mus musculus (mouse): 14870Help
Entry
14870             CDS       T01002                                 

Gene name
Gstp1, GstpiB
Definition
(RefSeq) glutathione S-transferase, pi 1
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05215  Prostate cancer
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14870 (Gstp1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14870 (Gstp1)
   00982 Drug metabolism - cytochrome P450
    14870 (Gstp1)
   00983 Drug metabolism - other enzymes
    14870 (Gstp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14870 (Gstp1)
   05204 Chemical carcinogenesis
    14870 (Gstp1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14870 (Gstp1)
   05215 Prostate cancer
    14870 (Gstp1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    14870 (Gstp1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    14870 (Gstp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14870 (Gstp1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14870 (Gstp1)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   14870 (Gstp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Motif
Other DBs
NCBI-GeneID: 14870
NCBI-ProteinID: NP_038569
MGI: 95865
Ensembl: ENSMUSG00000060803
Vega: OTTMUSG00000046062
UniProt: P19157
Structure
PDB: 

Position
19 A; 19 3.75 cM
AA seq 210 aa AA seqDB search
MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGD
LTLYQSNAILRHLGRSLGLYGKNQREAAQMDMVNDGVEDLRGKYVTLIYTNYENGKNDYV
KALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLLSAY
VARLSARPKIKAFLSSPEHVNRPINGNGKQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgccaccatacaccattgtctacttcccagttcgagggcggtgtgaggccatgcgaatg
ctgctggctgaccagggccagagctggaaggaggaggtggttaccatagatacctggatg
caaggcttgctcaagcccacttgtctgtatgggcagctccccaagtttgaggatggagac
ctcaccctttaccaatctaatgccatcttgagacaccttggccgctctttggggctttat
gggaaaaaccagagggaggccgcccagatggatatggtgaatgatggggtggaggacctt
cgcggcaaatatgtcaccctcatctacaccaactatgagaatggtaagaatgactacgtg
aaggccctgcctgggcatctgaagccttttgagaccctgctgtcccagaaccagggaggc
aaagctttcatcgtgggtgaccagatctcctttgccgattacaacttgctggacctgctg
ctgatccaccaagtcctggcccctggctgcctggacaacttccccctgctctctgcctat
gtggctcgcctcagtgcccggcccaagatcaaggcctttctgtcctccccggaacatgtg
aaccgtcccatcaatggcaatggcaaacagtag

DBGET integrated database retrieval system