KEGG   Mus musculus (mouse): 14872Help
Entry
14872             CDS       T01002                                 

Gene name
Gstt2, AI266894, Yrs, mGSTT2
Definition
(RefSeq) glutathione S-transferase, theta 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14872 (Gstt2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14872 (Gstt2)
   00982 Drug metabolism - cytochrome P450
    14872 (Gstt2)
   00983 Drug metabolism - other enzymes
    14872 (Gstt2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    14872 (Gstt2)
   05204 Chemical carcinogenesis
    14872 (Gstt2)
   05225 Hepatocellular carcinoma
    14872 (Gstt2)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    14872 (Gstt2)
  09168 Drug resistance
   01524 Platinum drug resistance
    14872 (Gstt2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14872 (Gstt2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14872 (Gstt2)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14872 (Gstt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 14872
NCBI-ProteinID: NP_034491
MGI: 106188
Ensembl: ENSMUSG00000033318
UniProt: Q61133
Position
10 C1; 10 38.58 cM
AA seq 244 aa AA seqDB search
MGLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDG
SFVLTESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLG
PLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTLADLMSLEELMQPVALG
YNLFEGRPQLTAWRERVEAFLGAELCQEAHSTILSILGQAAKKMLPVPPPEVHASMQLRI
ARIP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggcttggagctctacctggacctgctgtcacaacccagccgcgctgtctacatcttc
gccaagaagaatggcatccccttccagacgcgtaccgtggatatactcaaagggcagcac
atgagcgagcaattctcccaggtgaactgcttaaacaaagttcctgtactcaaagacgga
agcttcgtgttgaccgaaagcacagccatcttgatttacctgagttccaagtaccaggtg
gcagaccactggtacccggccgacctacaggcccgtgcccaagtccacgaatacctgggc
tggcatgccgacaacatccgtggtactttcggagtgctcctatggaccaaggtgttgggg
ccactcattggggtccaggttccccaggagaaggtggaacggaacagagatagaatggtc
ctggttctgcaacagctggaggacaagttcctcagggacagggccttccttgttggccag
caggtgacgctagcggatctcatgtctctggaggagttgatgcagcccgtggctcttggc
tataacctgtttgagggacggcctcagctgacagcatggcgagagagggtggaggcgttc
ttgggtgctgagctgtgtcaggaggctcatagcaccatcctgagcatcctgggacaggca
gccaagaaaatgttaccagtaccccctccggaggtccatgccagcatgcagcttcgaatt
gctaggattccttga

DBGET integrated database retrieval system