KEGG   Mus musculus (mouse): 14873Help
Entry
14873             CDS       T01002                                 

Gene name
Gsto1, AA407097, AI194287, AU018802, Gsto-1, Gstx, Spg-r, p28
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01524  Platinum drug resistance
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14873 (Gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    14873 (Gsto1)
   00982 Drug metabolism - cytochrome P450
    14873 (Gsto1)
   00983 Drug metabolism - other enzymes
    14873 (Gsto1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    14873 (Gsto1)
   05204 Chemical carcinogenesis
    14873 (Gsto1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    14873 (Gsto1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    14873 (Gsto1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    14873 (Gsto1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14873 (Gsto1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     14873 (Gsto1)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   14873 (Gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 14873
NCBI-ProteinID: NP_034492
MGI: 1342273
Ensembl: ENSMUSG00000025068
Vega: OTTMUSG00000028264
UniProt: O09131
Position
19; 19 D1
AA seq 240 aa AA seqDB search
MSGESSRSLGKGSAPPGPVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEVININLKNKP
EWFFEKNPLGLVPVLENSQGHLVTESVITCEYLDEAYPEKKLFPDDPYKKARQKMTLESF
SKVPPLIASFVRSKRKEDSPNLREALENEFKKLEEGMDNYKSFLGGDSPSMVDYLTWPWF
QRLEALELKECLAHTPKLKLWMAAMQQDPVASSHKIDAKTYREYLNLYLQDSPEACDYGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggagaatcctccaggagcctggggaagggaagcgcgccccccggcccggtcccg
gagggccagatccgcgtctacagcatgaggttctgccccttcgctcagaggacgctgatg
gtcctgaaggccaagggaatccggcacgaagtcatcaatatcaacctgaagaataagccc
gagtggttctttgagaagaatccccttgggctggtgccggttctggagaacagccagggt
cacttggtcaccgaatctgtcatcacttgtgagtacctggatgaggcctacccagagaag
aagttatttccagatgacccgtacaagaaggcacgtcagaagatgacccttgagtcattc
tctaaggtgccgcctttgattgcaagctttgttaggtcgaagagaaaggaagactctccg
aacctaagggaagcgttggagaacgaattcaaaaagctagaggagggcatggataattac
aagagcttccttggtggggattctccttctatggttgattatcttacttggccttggttt
cagcgactggaagcattggagctcaaggagtgtctagcccacacccccaagctcaagctc
tggatggcggccatgcagcaagaccctgtggcatcctctcacaaaattgatgccaagacc
taccgcgagtacttaaatctctacctacaggacagccccgaggcctgtgattatgggctc
tga

DBGET integrated database retrieval system