KEGG   Mus musculus (mouse): 14904
Entry
14904             CDS       T01002                                 

Symbol
Gtpbp1, AL022987, AW045683, C85212, GP-1, Gtpbp
Name
(RefSeq) GTP binding protein 1
  KO
K24887  GTP-binding protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    14904 (Gtpbp1)
   03016 Transfer RNA biogenesis [BR:mmu03016]
    14904 (Gtpbp1)
   03012 Translation factors [BR:mmu03012]
    14904 (Gtpbp1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Other surveillance factors
     14904 (Gtpbp1)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    14904 (Gtpbp1)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Elongation factors
   Elongation associated factors
    14904 (Gtpbp1)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D2 GTP_EFTU_D3 MMR_HSR1 Dynamin_N DO-GTPase2
Other DBs
NCBI-GeneID: 14904
NCBI-ProteinID: NP_038846
MGI: 109443
Ensembl: ENSMUSG00000042535
UniProt: O08582
Structure
Position
15:79574202..79605680
AA seq 668 aa
MAAERSRSPVDSPVPASMFAPEPSSPGAARAAAAAARLHGGFDSDCSEDGEALNGEPELD
LTSKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATV
KSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVL
THGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKI
CEKSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALN
VPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMC
PIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGL
IKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMV
SPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATV
HFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKGPLS
KREEGGPCGVPAAGGPPTGDEASSLGTAQAASTSGLQPQPKPSSGGRRRGGQRHKVKSGA
CVTPASGC
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggcggcggagcggagtcgctccccggtcgactcgccggtgccggcctcgatgttcgcc
cccgagcctagctctccgggggcggctcgggccgccgcggccgcggcccgactccatggc
ggcttcgattctgactgcagcgaggacggcgaggcgctcaacggcgagccggagctggac
ctcaccagcaagctggttctagtgagccctacatcagagcagtatgacagcctacttcgg
cagatgtgggagaggatggacgagggatgcggagagaccatatatgtcattgggcaggga
tcagatgggactgagtacgggctgagtgaagctgacatggaggcctcctacgccaccgtg
aagagcatggcggagcagatagaggctgacgtcatcctcttacgagaacgtcaagaagcg
ggcggccgtgtgcgtgattacctagtcaggaaacgagttggagacaatgacttcctggag
gtcagggtggcagtggtgggcaacgtggatgctggcaaaagcacactcctgggagtccta
acacacggggagctggacaatggccgtggctttgcccgccaaaaactctttcgccacaaa
catgagattgaatctggtcgaaccagcagtgtgggcaatgacattctgggctttgacagc
gaaggcaatgtagtgaacaaacccgacagccatggtggcagcctcgaatggacaaagatc
tgtgagaagtcctctaaagtgatcaccttcatcgacttggctggccacgagaagtacctt
aagaccactgtttttggcatgactggccacttgcctgacttctgcatgctcatggtgggc
agcaatgctggcattgtggggatgaccaaggagcatctgggcttggcattggcactcaat
gtacctgtgtttgtggttgtcaccaagattgacatgtgtcctgccaacatccttcaagaa
accctgaagctgctacagcgcctgctgaagtcaccaggctgccggaagatccctgtcctg
gtgcagagcaaagatgatgtgattgtcacagcctccaacttcagctctgagaggatgtgc
ccgatattccagatctccaatgtcacaggtgagaaccttgacctgctcaagatgttcctc
aacctcctgtccccccgcaccagctaccgggaggaggagcctgctgagttccagatagat
gacacctactctgtccctggcgtggggacagtggtgtctgggaccaccctgcggggcctg
atcaaactgaacgacacactgctgctgggcccagaccccttggggaacttcctgtccatt
gctgtcaagtcaatccatcgcaaacgtatgccagtcaaggaggtgcgcgggggccagaca
gcctcctttgcactgaagaagataaagcgctcatccatccggaaaggcatggtgatggtt
tccccacgcctgaatccccaggcctcctgggagtttgaggctgagatccttgtcctccac
caccccaccacaattagtccacgataccaagccatggtacactgtgggagcatccggcaa
acagctacaattctgagcatggataaagactgtctgcgcacaggagacaaggccactgtc
cacttccgcttcatcaagaccccagagtatctgcacatagaccagcggttggtgttccgg
gaaggtcgaaccaaggctgttggcaccatcaccaagctcctccagacaaccaacaactcc
cccatgaactccaagccccagcagattaaaatgcagtccacaaaaaagggtcccctgagc
aaacgagaggaaggaggtccatgtggggtgccggcggcagggggacccccgactggagat
gaagcttcctcactagggactgcacaggctgcctcaaccagtgggctccagccacagccc
aagcccagcagtgggggccggcgacgagggggccagcgccacaaggtgaagtcgggagcc
tgtgtgactcctgccagcggctgctga

DBGET integrated database retrieval system