KEGG   Mus musculus (mouse): 14912Help
Entry
14912             CDS       T01002                                 

Gene name
Nkx6-2, Gtx, Nkx6.2
Definition
(RefSeq) NK6 homeobox 2
  KO
K09350  homeobox protein Nkx-6.2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14912 (Nkx6-2)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    14912 (Nkx6-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain PKK Homez
Motif
Other DBs
NCBI-GeneID: 14912
NCBI-ProteinID: NP_899071
MGI: 1352738
Ensembl: ENSMUSG00000041309
Vega: OTTMUSG00000024503
UniProt: D3Z4R4
Position
7 F4; 7 84.57 cM
AA seq 277 aa AA seqDB search
MDANRPGAFVLSSAPLAALHNMAEMKTSLFPYALQGPAGFKTPALGSLGAQLPLGTPHGI
SDILGRPVGAAGGGLLGSLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPG
VVQGSPWRDPRLAGSAQAGGVLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERAR
LAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKQDSDAEKLKVGGSDAEDDDEYNR
PLDPNSDDEKITRLLKKHKPSNLALVSPCGGSAGDAL
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggacgctaaccgcccgggtgcgtttgtgctgagcagcgcgcctttagccgcgctgcac
aacatggctgagatgaagacgtcgctgttcccctacgcgctgcagggcccggcgggcttc
aagacacccgccctaggcagccttggcgcgcagttgcctctaggcactccgcacggcatc
agcgacatcctgggacggccggtgggcgcagcgggtggcggcctcctaggaagtctgccc
cgtctcaacgggctcgcctcgtctgcaggtgtctacttcgggcccgcagccgccgtggct
cggggctaccccaagccgctggcggaactgcctgggcgcccgcccatcttctggcctggg
gtggtgcagggctctccctggagggacccgcgactggccggctccgcccaagccggcggg
gtcctggataaggatggcaagaagaaacactcgcggccgactttctccggccagcagatc
ttcgcgctggagaagactttcgagcagaccaagtatttggcaggcccagagcgcgcgcgg
cttgcctactctctgggcatgaccgagagccaagtgaaggtgtggttccagaatcggcgg
accaagtggcgcaagcggcacgcggcagagatggcgtcggctaaaaagaagcaagactcg
gatgccgagaagctgaaggtgggtggctcagacgcggaggacgatgacgaatacaaccgg
cccctggaccccaactccgatgacgagaagatcacgcggcttctcaaaaagcacaaaccc
tcgaacttggcgctcgttagcccgtgtggtggcagcgcgggggacgccttgtga

DBGET integrated database retrieval system