KEGG   Mus musculus (mouse): 14917
Entry
14917             CDS       T01002                                 

Symbol
Gucy2c, AI893437, GC-C, Gcc
Name
(RefSeq) guanylate cyclase 2c
  KO
K12320  heat-stable enterotoxin receptor [EC:4.6.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    14917 (Gucy2c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14917 (Gucy2c)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     14917 (Gucy2c)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   14917 (Gucy2c)
SSDB
Motif
Pfam: Guanylate_cyc PK_Tyr_Ser-Thr Pkinase ANF_receptor Amnionless LapA_dom
Other DBs
NCBI-GeneID: 14917
NCBI-ProteinID: NP_001120790
MGI: 106903
Ensembl: ENSMUSG00000042638
Vega: OTTMUSG00000033823
UniProt: Q3UWA6
Position
6 G1; 6 66.67 cM
AA seq 1072 aa
MTSLLGLAVRLLLFQPALMVFWASQVRQNCRNGSYEISVLMMDNSAYKEPMQNLREAVEE
GLDIVRKRLREADLNVTVNATFIYSDGLIHKSGDCRSSTCEGLDLLREITRDHKMGCALM
GPSCTYSTFQMYLDTELNYPMISAGSYGLSCDYKETLTRILPPARKLMYFLVDFWKVNNA
SFKPFSWNSSYVYKNGSEPEDCFWYLNALEAGVSYFSEVLNFKDVLRRSEQFQEILTGHN
RKSNVIVMCGTPESFYDVKGDLQVAEDTVVILVDLFSNHYFEENTTAPEYMDNVLVLTLP
SEQSTSNTSVAERFSSGRSDFSLAYLEGTLLFGHMLQTFLENGENVTGPKFARAFRNLTF
QGFAGPVTLDDSGDIDNIMSLLYVSLDTRKYKVLMKYDTHKNKTIPVAENPNFIWKNHKL
PNDVPGLGPQILMIAVFTLTGILVVLLLIALLVLRKYRRDHALRQKKWSHIPSENIFPLE
TNETNHISLKIDDDRRRDTIQRVRQCKYDKKKVILKDLKHSDGNFSEKQKIDLNKLLQSD
YYNLTKFYGTVKLDTRIFGVVEYCERGSLREVLNDTISYPDGTFMDWEFKISVLNDIAKG
MSYLHSSKIEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKDLWTAPEHLRQATISQK
GDVYSFAIIAQEIILRKETFYTLSCRDHNEKIFRVENSYGKPFRPDLFLETADEKELEVY
LLVKSCWEEDPEKRPDFKKIESTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVEE
RTQLYKAERDRADHLNFMLLPRLVVKSLKEKGIVEPELYEEVTIYFSDIVGFTTICKYST
PMEVVDMLNDIYKSFDQIVDHHDVYKVETIGDAYVVASGLPMRNGNRHAVDISKMALDIL
SFIGTFELEHLPGLPVWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLR
IHMSSSTITILKRTDCQFLYEVRGETYLKGRGTETTYWLTGMKDQEYNLPSPPTVENQQR
LQTEFSDMIVSALQKRQASGKKSRRPTRVASYKKGFLEYMQLNNSDHDSTYF
NT seq 3219 nt   +upstreamnt  +downstreamnt
atgacgtcactgctgggcttggctgtgcggttactgctcttccagcccgcgctgatggtg
ttctgggcctctcaggtgaggcagaactgccgcaatggcagctacgagatcagcgtcctg
atgatggacaactcagcctacaaagaacctatgcaaaacctgagggaggctgtggaggaa
ggactggacatagtgcgaaagcgcctgcgtgaagccgacctaaatgtgactgtgaacgcg
actttcatctactccgacggtctgattcataagtcaggtgactgccggagcagcacctgt
gaaggccttgacctactcagggagattacaagagatcataagatgggctgcgccctcatg
gggccctcgtgcacgtattccaccttccagatgtacctcgacacagagttgaactatccc
atgatttccgctggaagttatggattgtcctgtgactataaggaaaccctaaccaggatc
ctgcctccagccaggaagctgatgtacttcttggtcgatttctggaaagtcaacaatgca
tctttcaaacccttttcctggaactcttcgtatgtttacaagaatggatcggaacctgaa
gattgtttctggtacctcaatgctctggaggctggggtgtcctatttttctgaggtgctc
aacttcaaggatgtactgagacgcagcgaacagttccaggaaatcttaacaggccataac
agaaagagcaatgtgattgttatgtgtggcacgccagaaagcttctatgatgtgaaaggt
gacctccaagtggctgaagatactgttgtcatcctggtagatctgttcagtaaccattac
tttgaggagaacaccacagctcctgagtatatggacaatgtcctcgtcctgacgctgccg
tctgaacagtccacctcaaacacctctgtcgccgagaggttttcatcggggagaagtgac
ttttctctcgcttacttggagggaaccttgctatttggacacatgctgcagacgtttctt
gaaaatggagaaaatgtcacgggtcccaagtttgctcgtgcattcaggaatctcactttt
caaggctttgcaggacctgtgactctggatgacagtggggacattgacaacattatgtcc
cttctgtatgtgtctctggataccaggaaatacaaggttcttatgaagtatgacacccac
aaaaacaaaactattccggtggctgagaaccccaacttcatctggaagaaccacaagctc
cccaatgacgttcctgggctgggccctcaaatcctgatgattgccgtcttcacgctcacg
gggatcctggtagttctgctgctgattgccctcctcgtgctgagaaaatacagaagagat
catgcacttcgacagaagaaatggtcccacattccttctgaaaacatctttcctctggag
accaacgagaccaaccacatcagcctgaagattgacgatgacaggagacgagacacaatc
cagagagtgcgacagtgcaaatacgacaagaagaaagtgattctgaaagacctcaagcac
agcgacgggaacttcagtgagaagcagaagatagacctgaacaagttgctgcagtctgac
tactacaacctgactaagttctacggcaccgtgaagctggacaccaggatctttggggtg
gttgagtactgcgagaggggatccctccgggaagtgttaaacgacacaatttcctaccct
gacggcacgttcatggattgggagtttaagatctctgtcttaaatgacatcgctaagggg
atgtcctacctgcactccagtaagattgaagtccacgggcgtctcaaatccaccaactgc
gtggtggacagccgcatggtggtgaagatcaccgactttgggtgcaattccatcctgcct
ccaaaaaaagacctgtggacggccccggagcacctgcgccaggccaccatctctcagaaa
ggagacgtgtacagcttcgccatcattgcccaggagatcatcctccgtaaggagactttt
tacacgctgagctgtcgggatcacaatgagaagattttcagagtggaaaattcatacggg
aaacctttccgcccagacctcttcctggagactgcagatgagaaggagctggaggtctat
ctacttgtcaaaagctgttgggaggaggatccagaaaagaggccagatttcaagaaaatc
gagagcacactggccaagatatttggccttttccatgaccagaaaaacgagtcttacatg
gacaccttgatccgacgtctccagctgtactctcgaaacctggaacatctggtggaggaa
aggactcagctgtacaaggcggagagggacagggctgaccaccttaacttcatgctcctc
ccacggctggtggtaaagtcactgaaggagaaaggcatcgtggagccagagctgtacgaa
gaagtcacaatctacttcagtgacattgtgggcttcaccaccatctgcaagtatagcacg
cccatggaggtggtggacatgctcaacgacatctacaagagctttgaccagattgtggac
caccatgacgtctacaaggtagaaaccatcggtgacgcctacgtggtggccagcggtctg
cctatgagaaacggcaaccgacacgcggtagacatttccaagatggccttggacatcctc
agcttcatagggacctttgagttggagcatctccctggcctccccgtgtggatccgcatt
ggagttcattctgggccctgcgctgctggtgttgtggggatcaagatgcctcgctattgc
ctgtttggagacactgtcaacactgcctccaggatggaatccaccggcctccccttgagg
attcacatgagcagctccaccataaccatcctgaagagaacggattgccagttcctgtat
gaagtgaggggagaaacctacttaaagggaagagggacagagaccacatactggctgact
gggatgaaggaccaagaatacaacctgccatccccaccgacagtggagaaccaacagcgt
ctgcagactgagttctcagacatgatcgttagcgccttacagaaaagacaggcctcgggc
aagaagagccggaggcccactcgggtggccagctacaagaaaggctttctggaatacatg
cagctgaacaattcagaccacgatagcacctatttttag

DBGET integrated database retrieval system