KEGG   Mus musculus (mouse): 14919Help
Entry
14919             CDS       T01002                                 

Gene name
Gucy2e, GC-E, GC1, ROS-GC1
Definition
(RefSeq) guanylate cyclase 2e
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu04740  Olfactory transduction
mmu04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    14919 (Gucy2e)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    14919 (Gucy2e)
   04740 Olfactory transduction
    14919 (Gucy2e)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14919 (Gucy2e)
Enzymes [BR:mmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     14919 (Gucy2e)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   14919 (Gucy2e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Kinase-like
Motif
Other DBs
NCBI-GeneID: 14919
NCBI-ProteinID: NP_032218
MGI: 105123
Ensembl: ENSMUSG00000020890
Vega: OTTMUSG00000005963
UniProt: P52785
Position
11 B3; 11 42.51 cM
AA seq 1108 aa AA seqDB search
MSAWLLPAGGLPGAGFCVPARQSPSSFSRVLRWPRPGLPGLLLLLLLPSPSALSAVFKVG
VLGPWACDPIFARARPDLAARLAANRLNRDFALDGGPRFEVALLPEPCLTPGSLGAVSSA
LSRVSGLVGPVNPAACRPAELLAQEAGVALVPWGCPGTRAAGTTAPAVTPAADALYVLLR
AFRWARVALITAPQDLWVEAGRALSTALRARGLPVALVTSMETSDRSGAREALGRIRDGP
RVRVVIMVMHSVLLGGEEQRYLLEAAEELALTDGSLVFLPFDTLHYALSPGPEALAAFVN
SSQLRRAHDAVLTLTRRCPPGGSVQDSLRRAQEHQELPLDLNLKQVSPLFGTIYDAVFLL
AGGVKRARTAVGGGWVSGASVARQVREAQVSGFCGVLGRTEEPSFVLLDTDASGEQLFAT
HLLDPVLGSLRSAGTPMHFPRGGPAPGPDPSCWFDPDVICNGGVEPGLVFVGFLLVIGMG
LTGAFLAHYLRHRLLHMQMASGPNKIILTLEDVTFLHPPGGSSRKVVQGSRSSLATRSAS
DIRSVPSQPQESTNVGLYEGDWVWLKKFPGEHHMAIRPATKTAFSKLRELRHENVALYLG
LFLAGTADSPATPGEGILAVVSEHCARGSLHDLLAQREIKLDWMFKSSLLLDLIKGMRYL
HHRGVAHGRLKSRNCVVDGRFVLKVTDHGHGRLLEAQRVLPEPPSAEDQLWTAPELLRDP
SLERRGTLAGDVFSLAIIMQEVVCRSTPYAMLELTPEEVIQRVRSPPPLCRPLVSMDQAP
MECIQLMTQCWAEHPELRPSMDLTFDLFKSINKGRKTNIIDSMLRMLEQYSSNLEDLIRE
RTEELEQEKQKTDRLLTQMLPPSVAEALKMGTSVEPEYFEEVTLYFSDIVGFTTISAMSE
PIEVVDLLNDLYTLFDAIIGAHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDIL
SAVGSFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYR
IHVNMSTVRILRALDQGFQMECRGRTELKGKGIEDTYWLVGRLGFNKPIPKPPDLQPGAS
NHGISLQEIPPERRKKLEKARPGQFTGK
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcttggctcctgccagccggagggcttcccggcgccgggttctgtgtccctgcg
cggcagtctccgtccagtttctcgcgggtcctgcgctggccaaggcctgggctaccggga
ctcctgctactgctactgctcccatctccttctgccctctctgctgtgttcaaagtgggg
gtgctgggcccctgggcttgcgaccccatctttgcacgggcccgaccagacctggctgcg
cgtctggccgccaaccgcctgaatcgtgactttgctttagacggcggcccccggttcgag
gttgcgctgctcccagagccctgcctgactccgggctcactaggggctgtgtcctctgcg
ctgtctcgagtctctggcctggtgggtccggtgaaccccgcagcctgtcggccagccgaa
ctgttggctcaagaagctggagtagcgctggtgccctggggctgccctggcacgcgggcg
gcgggtactacagccccggcggtgacccccgctgcagatgctctctacgtcctccttaga
gcattccgctgggcgcgcgtggccctgatcactgcaccccaagacctgtgggtggaggcg
ggacgcgctctgtccacagcactcagggcccggggtttgccagttgccctagtgacttcc
atggagacttcagaccggtctggagcccgggaggccctcgggaggatccgagatgggcct
agagttagagtagtgatcatggtgatgcactcggtgctgctgggcggcgaggagcagcgc
tacctactggaagctgcagaagaactggctctgactgatggctccctggttttcctgccc
ttcgacacgcttcactacgctttgtctccaggcccggaggctctggctgcatttgtcaac
agctcccagctccgcagggctcacgatgcggtgctcacactcacgcgccgctgtcctcct
ggaggcagcgtgcaagacagcctgcgcagggctcaagaacaccaggaactgccccttgac
ctcaacctgaagcaggtctctccgctgtttggcaccatctatgatgctgtcttcctgttg
gctgggggcgtgaagagagcaagaacagcggtgggtggtggctgggtgtcaggtgcatct
gtagcccgccaagtacgggaagcacaagtctctggcttttgtggggtcctgggaagaacc
gaggagccctcctttgtgctgctggacacagatgcatccggagaacagttgttcgcaaca
cacctgctagatcctgtcttaggctccctgcgttctgcagggacccccatgcacttccct
agaggtggacctgccccgggaccagacccttcctgctggttcgatccagatgtgatctgc
aacggaggggtggagccaggcctggtctttgttggcttcctcctggtgatagggatggga
ctgactggagccttcttggctcattacttgaggcacaggctgctacacatgcagatggct
tccggccccaacaagatcatcttgacgttggaagatgttactttcctccacccaccggga
ggcagctctcgaaaggtggtccagggaagtagatccagtctggctacccggagcgcatca
gacattcgcagtgtccccagccagccccaagagagcaccaacgttggcctctatgagggg
gactgggtttggctgaagaagttcccaggggaacatcatatggctatcaggccagcaaca
aagacagccttctccaagcttcgagagctccggcatgagaatgtggctctctacttggga
ctcttcctggcgggtacagcagacagccctgccacccctggggagggcatcttggctgtg
gtctcagagcactgtgctcggggttccctccatgacctcctggcccagagagaaataaag
ctggactggatgttcaagtcttccctcctgctggacctcatcaagggaatgagatatctg
caccatcgcggtgtggcccacgggaggctcaagtcacggaattgcgtggtggacgggagg
ttcgtgctcaaggtgacagatcatggccatgggcgactgctggaagcgcaaagggtgtta
ccggaacctcccagtgcagaggatcagctatggacagccccagagcttcttcgggacccc
tccctggagcgccggggaactctagctggtgatgtctttagtctggccatcatcatgcag
gaggtcgtgtgccgcagcaccccttatgccatgctggaactaacgcccgaggaagtaata
cagagggtgcggagccctcctccactgtgtcggcccttggtgtccatggaccaggcaccc
atggagtgcatccagctgatgacacaatgctgggcagagcatccagaacttcggccttcc
atggacctcacctttgacctgttcaagagcatcaacaagggccggaagaccaacatcatc
gactccatgcttcggatgctggagcagtactctagtaacctggaggatctgatccgagaa
cgcacagaggagttagagcaggagaagcagaagacagacaggctgctcacacagatgctg
cctccatctgtggctgaggccctgaagatggggacatctgtggagcctgagtactttgaa
gaggtgacactctacttcagtgacatcgtgggctttaccaccatttcagccatgagcgag
cctattgaggtggtagacctgcttaatgacctctatactctcttcgatgccatcatcggt
gcccatgatgtctataaggtggaaacaattggagatgcatatatggtggcctccgggctg
ccgcagaggaacgggcagcggcacgctgcagagattgccaacatgtcactggacatcctc
agtgcagtcggctccttccgcatgcgccatatgcccgaggtaccggtgcgcatccgcatt
ggtttgcactcaggcccgtgcgtggcgggtgtggtgggcctcaccatgcctcggtactgc
ctgttcggggacacggtcaacactgcctcgagaatggagtccactggactgccttaccgc
atccacgttaacatgagcactgttcggattcttcgcgctctggaccaaggcttccagatg
gagtgtcgaggccgcacggagctgaagggcaagggtattgaggacacgtactggcttgtg
ggcagacttggcttcaacaagcccattcccaaaccacctgatctgcagccaggggccagc
aaccatggtatcagcctgcaggagattcccccagagagacgcaagaagctggagaaagcc
aggccaggccagtttactgggaagtga

DBGET integrated database retrieval system