KEGG   Mus musculus (house mouse): 14923
Entry
14923             CDS       T01002                                 
Symbol
Guk1, AA409738, AL033299, AL033300, AV026611, Gmk, Guk-1
Name
(RefSeq) guanylate kinase 1
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu01232  Nucleotide metabolism
Module
mmu_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    14923 (Guk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     14923 (Guk1)
SSDB
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_18 RsgA_GTPase MMR_HSR1 ABC_tran AAA_22 KAP_NTPase NACHT AAA_14 AAA_29 AAA_30 AAA_28 AAA RNA_helicase Rad17 NTPase_1 cobW NB-ARC ATPase_2 VirE TsaE Zeta_toxin AAA_24 Viral_helicase1 AAA_7 DUF2075 Mg_chelatase AAA_17 Dynamin_N AAA_23
Other DBs
NCBI-GeneID: 14923
NCBI-ProteinID: NP_001152882
MGI: 95871
Ensembl: ENSMUSG00000020444
UniProt: Q64520 E9Q7K1
Structure
Position
11:complement(59074681..59083033)
AA seq 207 aa
MEAATHQVGMAGPRPVVLSGPSGAGKSTLLKKLFQEHSSIFGFSVSHTTRNPRPGEEDGK
DYYFVTREMMQRDIAAGDFIEHAEFSGNLYGTSKEAVRAVQAMNRICVLDVDLQGVRSIK
KTDLCPIYIFVQPPSLDVLEQRLRLRNTETEESLAKRLAAARTDMESSKEPGLFDLVIIN
DDLDKAYATLKQALSEEIKKAQGTGHA
NT seq 624 nt   +upstreamnt  +downstreamnt
atggaggctgcaacacatcaagtaggcatggcaggacctaggccagtagtgctgagcggg
ccgtcaggggcagggaagagcactctgctcaagaagctgttccaggagcacagcagcatc
ttcggcttcagcgtgtctcatactacaaggaacccacgacctggtgaagaagatggcaaa
gattactactttgtgaccagggagatgatgcagcgtgatattgcagcaggggacttcatt
gagcatgctgagttctcagggaacctgtacgggacaagcaaggaagctgttcgggctgtg
caggccatgaaccgcatctgcgtgctagatgtcgacctacaaggtgtgcgcagcatcaag
aagactgatctgtgtcccatctacatctttgtgcagcctccctcgctggacgtgctggag
caacgactgcgactgcgcaacactgagactgaggagagtctggcaaagcggctggcagct
gcacggacagacatggagagcagcaaggagcctggcttgtttgacctggtgatcatcaat
gacgacctggataaagcctatgcaaccctgaagcaggcgctctctgaggaaatcaagaaa
gcacagggaactggccacgcctga

DBGET integrated database retrieval system