KEGG   Mus musculus (mouse): 14924
Entry
14924             CDS       T01002                                 

Gene name
Magi1, A, AIP3, BAP1, Ba, Baiap1, Gukmi, Gukmi1, MAGI1c, Magi-1, TNRC19, WWP, WWP3, mKIAA4129
Definition
(RefSeq) membrane associated guanylate kinase, WW and PDZ domain containing 1
  KO
K05631  atrophin-1 interacting protein 3 (BAI1-associated protein 1)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04530  Tight junction
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    14924 (Magi1)
   04151 PI3K-Akt signaling pathway
    14924 (Magi1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    14924 (Magi1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    14924 (Magi1)
SSDB
Motif
Pfam: PDZ PDZ_6 MAGI_u5 MAGI_u1 PDZ_2 WW Guanylate_kin Tricorn_PDZ Serglycin
Other DBs
NCBI-GeneID: 14924
NCBI-ProteinID: NP_001025021
MGI: 1203522
Ensembl: ENSMUSG00000045095
Vega: OTTMUSG00000057755
UniProt: Q6RHR9
Structure
PDB: 
5ZYS 2I04

Position
6; 6 D1
AA seq 1471 aa
MSKVIQKKNHWTGRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAAEAAGLPGGGE
GPKLAEGELLLEVQGVRVSGLPRYDVLGVIDSCKEAVTFKAVRQGGRLNKDLRHFLNQRF
QKGSPDHELQQTIRDNLYRHAVPCTTRSPREGEVPGVDYSFLTVKEFLDLEQSGTLLEVG
TYEGNYYGTPKPPSQPVSGKVITTDALHSLQSGSKQSTPKRTKSYNDMQNAGIVHPENEE
EEDVPEMNSSFTADSGDQDEHTLQEATLPPVNSSILAAPITDPSQKFPQYLPLSAEDNLG
PLPENWEMAYTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDDEGVHTEELDSELE
LPAGWEKIEDPVYGVYYVDHINRKTQYENPVLEAKRKKQLEQQQQQQQPQPPQPEEWTED
HASVVPPVAPSHPPSNPEPARETPLQGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVG
GDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASV
DLELCRGYPLPFDPDDPNTSLVTSVAILDKEPIIVNGQETYDSPASHSSKTGKVSSMKDA
RPSSPADVASNSSHGYPNDTVSLASSIATQPELITVHIVKGPMGFGFTIADSPGGGGQRV
KQIVDSPRCRGLKEGDLIVEVNKKNVQALTHNQVVDMLIECPKGSEVTLLVQRGGLPVPK
KSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHGIQVLPEYLPADAPAPDQTDSSGQKK
PDPFKIWAQSRSMYENRPMSPSPASGLSKGERDREINSTNFGECQIPDYQEQDIFLWRKE
TGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKSHQLVVQLM
QQAAKQGHVNLTVRRKVVFAVPKAENEVPSPASSHHSSNQPASLTEEKRTPQGSQNSLNT
VSSGSGSTSGIGSGGGGGSGVVSAVLQPYDVEIRRGENEGFGFVIVSSVSRPEAGTTFGR
IIEGSPADRCGKLKVGDRILAVNGCSITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNAT
LLTNAEKIATITTTHAPSQQGTQETRTTTKPKQDSQFEFKGPQAAQEQDFYTVELERGAK
GFGFSLRGGREYNMDLYVLRLAEDGPAERCGKMRIGDEILEINGETTKNMKHSRAIELIK
NGGRRVRLFLRRGDGSVPEYDPSSDRNGPSTGAQGVPEVRPGPPDHRPHPALESSYPPEL
HKSSQHAEKRAHAKDPKGNREHSKQPNEHHTWNGTSRKQDSGACRPKDRPPDAWREAQPE
RTATNGSKRRSPEKRREGTRSADNTLERREKHEKRREISPERKRERSPTRRKDSSPSRRR
RSLERLLDQRRSPERRRGGSPERRAKSTDRRRARSPERRRERSLDKRNRDDKVGHREREE
AGLKLEAGRSPRNPPEQRRRPYKECSTDLSI
NT seq 4416 nt   +upstreamnt  +downstreamnt
atgtcgaaagtgatccagaagaagaaccactggactggccgcgttcacgagtgcaccgtg
aagcggggaccccagggcgagctgggggtgacggtcctggggggcgcggagcatggggag
tttccgtacgtgggggcggtggcggcggccgaggcggcggggcttcccggcggtggcgag
gggccgaagctggccgaaggtgagctgctgctggaggtgcagggggtccgggtgtccggc
ttgccccgctatgacgtgctgggagtcatcgacagctgcaaggaggccgtcaccttcaaa
gccgtcagacaaggaggaaggctcaacaaggacctacgacatttcctcaaccaacggttc
cagaaggggtctccagatcatgagctccagcagaccataagggacaacctctaccgccat
gctgtgccttgcacaacccggtctcccagagaaggagaagtgcctggtgtggattacagc
tttctgactgtgaaggagttcttggacctcgagcagagcgggaccctgttggaagtcggc
acctatgaaggaaactattatgggacacccaaacctcctagccagccagtcagtgggaaa
gtgatcacgacggatgccttgcacagcctgcagtctggctccaagcagtcgacccctaag
cgaacaaagtcctacaatgatatgcaaaatgctggcatagtccacccggagaatgaggag
gaggaggatgtccctgaaatgaacagtagctttacagccgactctggagaccaggacgag
cacactctccaagaagcaacgctcccgcctgtgaatagtagcatcctcgctgctcccatc
acggacccttctcagaagttccctcagtacctacctctttctgcagaggataatttaggt
cctctacctgaaaactgggagatggcctatactgaaaatggagaagtctatttcatagac
cacaacacgaaaacaacatcatggttagaccctcggtgcctgaacaaacagcagaagcct
ctggaagaatgtgaagatgatgaaggggtacacaccgaggagctggacagtgaactagag
ttgcctgctggctgggaaaagattgaagaccctgtctacggtgtctactatgtagaccac
atcaacaggaagacgcaatatgaaaacccagtcctagaagccaaacggaagaaacagctt
gaacagcagcagcaacagcagcagcctcagccaccgcagccagaagagtggacagaggat
catgcatctgttgtgcctcctgttgctccttcccatcccccgagcaatccggagccagcc
agggaaactccacttcagggcaaacctttttttacaagaaacccctctgagctgaaaggc
aagttcattcacacgaagctacggaaaagcagccgaggctttggcttcacggtggttgga
ggagacgagcctgatgagttcctgcagatcaagagcctcgtcctcgatggtcctgccgca
ctggatggcaagatggagacaggggatgtaattgtgagtgtgaatgacacctgtgttttg
ggacacacacatgctcaagttgtgaaaatcttccagtccattcccattggtgccagtgtg
gaccttgaactctgcagaggttatccattgccttttgacccggatgaccctaatacaagt
ttagtgacctcggtggccattttggacaaagaaccaattattgtaaatggacaagagacc
tacgattcaccagcgagccacagtagtaaaacaggcaaagtcagcagcatgaaggatgcc
aggccaagcagccctgctgatgtggcttccaacagctctcatggttatcccaacgacaca
gtctccttggcttcctccatagccacccagccagagctaataactgttcacatagtcaaa
gggccaatgggatttggctttacgatcgcagacagtcccggtgggggtggccaaagagtg
aaacagattgttgacagtccacgctgcagaggcctcaaagaaggggatcttatcgtggag
gtgaataagaagaacgtgcaggccctgacgcacaatcaagtcgtggatatgctgattgaa
tgtcccaagggaagtgaggtcacactgttggtgcagcgaggagggctaccagttcccaag
aagagcccaaagtcgcagccactggagaggaaagacagccagaatagctcccagcacagc
gtctccagccaccggagcctgcacactgcgtccccgagccacggcatacaggtgctccct
gagtacctacctgcagacgcccctgctccagatcagaccgacagctctgggcagaaaaag
ccagatccttttaaaatctgggcccagtccaggagcatgtatgaaaaccgacctatgtca
ccttcgcctgcatcaggattgagcaagggtgaaagagacagagaaatcaattccacgaat
tttggagaatgtcagattccagattaccaggaacaggacatcttcctctggagaaaagaa
accggatttggatttaggattctgggtggaaatgaaccaggggaacccatttatatcggt
cacatcgtaccgctgggtgctgctgacacagacggccgcctgaggtctggagatgaatta
atctgtgtggatgggacaccagtaattgggaaatcacaccagctcgtggtccagcttatg
caacaagctgccaagcaaggccatgtcaatctcacagtgaggcggaaagtggtctttgcc
gtccccaaagcagagaatgaggtgccctcaccagcctcatcacaccacagtagcaaccag
cccgcgtccctgacggaggagaaacgcacaccgcaaggcagccagaactctctgaacact
gtgagctctggcagcggcagcaccagtggcattggcagtggtggcggcgggggcagcggt
gtggtgagcgctgtgctgcagccctatgatgtggagattcggcgtggggagaacgagggc
tttgggtttgtcatcgtgtcctccgtgagcagacccgaagcgggcacaaccttcggtcgg
attattgaggggagccctgctgaccgctgtggcaagctgaaagtaggagaccggatcttg
gcagtaaatggatgttccatcaccaacaaatcccattctgacattgtcaacctaatcaaa
gaagcgggcaacacagtgactctccgcatcatccccggggatgagtcctcaaatgccacg
ctgctgactaatgctgagaagattgccaccatcaccaccactcatgccccctctcagcag
gggacccaggaaacaaggaccaccaccaaaccaaagcaggattctcagtttgagttcaaa
ggaccgcaggctgcacaggagcaagatttctacactgtggaattggaaagaggggccaag
ggatttggctttagtcttcgagggggccgagaatataacatggatctttatgttctgcgc
ttggcagaggatggtcctgcagaaagatgtgggaagatgaggattggcgatgaaattcta
gagatcaatggtgagaccaccaaaaacatgaaacactctcgggccatagaactgatcaag
aatggcggccgcagggtccgtctgtttctgcggcggggagacggctcagtcccagaatat
gaccccagcagcgacaggaacggcccctccaccggtgcacaaggtgttccggaagtgagg
ccggggccgccagaccacagaccgcatccagccttggagtccagttacccacccgaactt
cacaaatcatcacaacatgccgaaaagcgagcacacgcgaaggatccaaaaggcaacagg
gagcacagcaaacaacccaacgaacatcacacctggaatggaacttctagaaaacaggac
agcggggcatgccggcccaaagaccggccacccgacgcatggagagaggcgcagccagag
cggacagccaccaatggttcaaagaggaggtcaccggagaagcgcagggaaggcacccgc
agcgctgacaacactttggaaagaagggagaagcatgagaagagaagagagatatctccc
gagaggaagcgagagcgttcacccacccggagaaaagatagctccccgagccgccggcgg
aggtccctcgaaagactcctggatcaaagacggtccccagagcgcagaagagggggctcc
cccgagaggagagccaaatccaccgacaggaggagggccaggtcccctgagcgcaggcga
gagcggtcactggacaaaaggaaccgggacgacaaggttggccaccgagaaagagaggag
gctggtctgaagctggaagcggggagaagcccccgaaatcccccagagcagagaaggcgg
ccttacaaagaatgtagcaccgacctcagcatctga

KEGG   Mus musculus (mouse): 50791
Entry
50791             CDS       T01002                                 

Gene name
Magi2, AIP-1, Ac, Acvri1, Acvrinp1, Acvrip1, Magi, Magi-2, S-S, S-SCAM, mKIAA0705
Definition
(RefSeq) membrane associated guanylate kinase, WW and PDZ domain containing 2
  KO
K05629  atrophin-1 interacting protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    50791 (Magi2)
   04151 PI3K-Akt signaling pathway
    50791 (Magi2)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 MAGI_u1 WW Guanylate_kin MAGI_u5
Other DBs
NCBI-GeneID: 50791
NCBI-ProteinID: NP_001164217
MGI: 1354953
Ensembl: ENSMUSG00000040003
Vega: OTTMUSG00000025140
UniProt: Q9WVQ1
Structure
PDB: 
6JJZ

Position
5; 5 A3
AA seq 1275 aa
MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKL
VSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGS
VDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEEFMELEKSGALLESGTYED
NYYGTPKPPAEPAPLLNVTDQILPGATPSAEGKRKRNKSVTNMEKASIEPPEEEEEERPV
VNGNGVVITPESSEHEDKSAGASGETPSQPYPAPVYSQPEELKDQMDDTKPTKPEENEDS
DPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDPI
YGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGAKPLQAPGFREKPLFTRDASQLK
GTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCV
LGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNGR
HNYETYLEYISRTSQSVPDITDRPPHSLHSMPADGQLDGTYPPPVHDDNVSMASSGATQA
ELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHTE
VVDILKDCPVGSETSLIIHRGGFFSPWKTPKPMMDRWENQGSPQTSLSAPAVPQNLPFPP
ALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVHL
RRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYV
IDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYSNSNHAAP
SSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGS
PADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPSS
EKQSPMAQQHSPLAQQSPLAQPSPATPNSPVAQPAPPQPLQLQGHENSYRSEVKARQDVK
PDIRQPPFTDYRQPPLDYRQPPGGDYSQPPPLDYRQHSPDTRQYPLSDYRQPQDFDYFTV
DMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHA
RAIELIKSGGRRVRLLLKRGTGQVPEYGMVPSSLSMCMKSDKHGSPYFYLLGHPKDTTNP
TPGVLPLPPPQACRK
NT seq 3828 nt   +upstreamnt  +downstreamnt
atgtccaaaagcttgaaaaagaaaagccactggactagcaaagtccacgagagtgtcatt
ggcaggaacccggagggccagctgggctttgaactgaaggggggcgcggaaaacggacag
ttcccctacctgggggaggtgaagccgggcaaggtggcctatgaaagcggcagcaagttg
gtgtccgaggagctgctgctggaggtgaacgagacccccgtggcggggctcaccatcagg
gacgttctggccgtgatcaaacactgcaaggaccccctccggctcaagtgtgtcaagcaa
ggaggaattgttgataaagaccttcgtcactacctcaacctaagatttcagaagggttct
gttgaccatgaactacagcaaatcatccgtgacaacctctacctccgcacagtgccatgc
accacaaggccacataaggagggtgaggtccctggagtggactacattttcataaccgtt
gaggagtttatggaattggagaaaagtggtgctctcctagaaagcgggacctatgaagac
aactactacggtaccccgaagcctccagctgaaccagcaccattattaaatgtaacagac
cagatacttccgggagctactccaagtgctgaggggaagcggaaaagaaataagtcagtg
accaacatggagaaagcaagtatagagcctccagaggaggaagaagaagaaaggcctgta
gtcaatggaaacggcgtggtcataaccccagaatccagtgaacatgaagacaaaagtgca
ggtgcctcaggggagacaccctcccagccttaccctgcacccgtgtacagccagcccgaa
gagctcaaggaccagatggacgatacaaagccaacaaagcctgaggagaacgaggactct
gatccattgcctgataactgggaaatggcctacacagagaagggggaagtctacttcatt
gaccataacacaaagacaacatcatggctggatccgcgacttgcgaaaaaggctaaacct
ccagaagagtgcaaagaaaatgagcttccatatggctgggaaaaaatcgatgatcctata
tatggcacttactatgttgaccacataaatagaagaacacagtttgaaaaccctgtcctg
gaagcaaaaaggaagctacagcaacataacatgccccacacagaacttggagcaaagccc
ctgcaggccccaggtttccgagaaaagccactcttcacccgggatgcatcccagttgaag
ggaacgttcctcagcaccaccctcaaaaagagcaacatgggctttgggtttaccatcatt
ggtggagacgagccggatgagtttctacaggtgaaaagtgtgatcccggatgggcctgcc
gcacaggatgggaaaatggagacaggtgatgtcattgtctatattaatgaagtttgtgtc
cttggacacactcatgcagatgttgtcaaacttttccagtctgttcctattggtcagagt
gtcaacttggtgttgtgtcgtggctaccctttgccctttgaccctgaagatcctgctaac
agcatggtgccaccccttgcaataatggagaggccacctccggtgatggtcaatggaaga
cataactatgaaacatacttggaatacatttctcggacctcacagtcggtcccagatatt
acagaccggccacctcattctttgcactccatgccagctgacggccagctagatggcacg
tatccaccacccgtccatgacgacaatgtgtctatggcttcgtctggagccactcaagct
gaacttatgaccttaaccattgtgaaaggtgcccagggatttggctttactattgccgac
agtcccacgggacagcgggtgaaacaaatccttgacattcagggatgccctgggctgtgt
gaaggagacctcattgttgagatcaaccaacagaatgtacagaacctgagccatacagaa
gtagtggatatacttaaggactgccccgttggaagtgagacttctttaatcatccatcga
ggaggtttcttttctccatggaaaactccaaagcctatgatggaccgatgggagaaccaa
ggcagtccacaaacaagtttatctgctccggccgtcccacagaacctgcccttcccacct
gcccttcacaggagctcctttcctgattcaacagaggcctttgacccacggaagcctgac
ccatatgagctctacgagaaatcgagagccatttatgaaagtaggcaacaagtgccaccc
aggaccagttttcgaatggattcctctggtccagattataaggaactggatgttcacctt
cggaggatggagtctggatttggctttagaatccttgggggagatgaacctggacagcct
attttgatcggagccgtcattgccatgggctcagctgacagagacggccgtctacaccca
ggagatgagcttgtctatgtcgatgggatcccagtggctggcaagacccaccgctatgtc
atcgacctcatgcaccacgcggcccgcaatgggcaggttaacctcactgtgagaagaaag
gtgctatgtggaggggagccctgcccagagaatgggaggagtccaggctctgtatcaact
caccacagctctccgcgcagtgactatgccacctactccaacagcaaccacgccgccccc
agcagcaatgcctcacctcctgaaggctttgcctcacacagcttgcagaccagtgatgtg
gtcattcaccgcaaagaaaacgaagggtttggcttcgtcatcatcagctctctgaacagg
cctgagtctggagccaccataactgtgccccataaaattggacgaatcattgatgggagc
cctgcagatcgctgtgccaaactcaaagtgggcgaccgtatcttagcagtcaacggccag
tctatcatcaacatgcctcacgctgacattgtgaagctcatcaaggacgccggtctcagt
gtcacccttcgcatcattcctcaggaggagctcaacagcccaacatcagcacccagttca
gagaaacagagccccatggcccagcagcacagccctctggcccagcagagtcctctggcc
cagccaagccccgccacccccaacagcccagtcgcacagccagctcctccccaacctctc
cagctgcaaggacacgaaaatagttacaggtcagaagttaaagcgaggcaagatgtgaag
ccagacatccggcagcctcccttcacagactacaggcagcccccgctggactacaggcag
cccccgggaggagactactcacagcccccacccttggactacaggcagcactctccagac
accaggcagtaccctctgtcagactacaggcagccacaggattttgattatttcactgtg
gacatggagaaaggagccaaaggatttggattcagcattcgtggaggaagggaatacaag
atggatctgtatgtgttgagattggcagaggatgggccagccataaggaacggcaggatg
agggtaggagatcagatcattgaaataaatggggaaagcacacgagacatgacccacgcc
agagcaatagaactcatcaagtctggaggaagaagagtgcggctgctgctgaagagaggc
acggggcaggtcccggagtatggaatggtaccttccagcctctccatgtgcatgaaaagt
gacaagcatgggtccccatatttctacttactgggccaccctaaagacacgacgaacccc
acgcctggagtgctgccgctgccgccgccccaggcctgccggaagtag

DBGET integrated database retrieval system