KEGG   Mus musculus (mouse): 14938
Entry
14938             CDS       T01002                                 

Symbol
Gzma, AW494114, Ctl, Ctla, Ctla-3, Ctla3, Hf, Hf1, SE, SE1, TS, TSP, TSP-1, TSP1
Name
(RefSeq) granzyme A
  KO
K01352  granzyme A [EC:3.4.21.78]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14938 (Gzma)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    14938 (Gzma)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.78  granzyme A
     14938 (Gzma)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   14938 (Gzma)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 14938
NCBI-ProteinID: NP_034500
MGI: 109266
Ensembl: ENSMUSG00000023132
UniProt: P11032 Q3U0N0
Position
13 D2.2; 13 63.93 cM
AA seq 260 aa
MRNASGPRGPSLATLLFLLLIPEGGCERIIGGDTVVPHSRPYMALLKLSSNTICAGALIE
KNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLK
KKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICND
EKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGV
YTFLSDKHLNWIKKIMKGSV
NT seq 783 nt   +upstreamnt  +downstreamnt
atgaggaacgcctctggtccccgggggccatctcttgctactctcctttttcttctgctt
attcctgaaggaggctgtgaaagaatcattggaggagacacggttgttcctcactcaaga
ccgtatatggctctacttaaacttagttcaaataccatctgtgctggcgctttgattgaa
aagaactgggtgttgactgctgcccactgtaacgtgggaaagagatctaagttcattctt
ggggctcactcaatcaataaggagccagaacaacagatattgactgttaagaaagcattt
ccctatccatgctatgatgaatatacacgtgagggggatctacaacttgtacggctaaag
aaaaaagcaacagttaacagaaatgtggctatccttcacctacctaaaaagggagatgat
gtgaaaccaggaaccagatgccgagtagcaggatgggggagatttggcaataagtcagct
ccctctgaaactctgagagaagtcaacatcactgtcatagacagaaaaatctgcaatgat
gaaaaacactataattttcatcctgtaattggactaaacatgatttgtgcaggggacctc
cgtggtggaaaggactcctgcaatggggattctggcagccctctgctatgtgatggtatt
ttgcgaggcatcacctcttttggtggagagaagtgtggagatcgccgatggcctggtgtc
tatactttcctctcagataaacacctcaattggataaagaagattatgaagggttctgtg
taa

DBGET integrated database retrieval system