KEGG   Mus musculus (mouse): 14939
Entry
14939             CDS       T01002                                 

Gene name
Gzmb, AI553453, CCP, CCP-1/C1, CCP-1/C11, CCP1, Ctl, Ctla, Ctla-1, Ctla1, GZB
Definition
(RefSeq) granzyme B
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04210  Apoptosis
mmu04650  Natural killer cell mediated cytotoxicity
mmu04940  Type I diabetes mellitus
mmu05202  Transcriptional misregulation in cancer
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    14939 (Gzmb)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    14939 (Gzmb)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    14939 (Gzmb)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    14939 (Gzmb)
   05330 Allograft rejection
    14939 (Gzmb)
   05332 Graft-versus-host disease
    14939 (Gzmb)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14939 (Gzmb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    14939 (Gzmb)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     14939 (Gzmb)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   14939 (Gzmb)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Pico_P2A
Other DBs
NCBI-GeneID: 14939
NCBI-ProteinID: NP_038570
MGI: 109267
Ensembl: ENSMUSG00000015437
UniProt: P04187 Q3TZH4
Position
14 C3; 14 28.19 cM
AA seq 247 aa
MKILLLLLTLSLASRTKAGEIIGGHEVKPHSRPYMALLSIKDQQPEAICGGFLIREDFVL
TAAHCEGSIINVTLGAHNIKEQEKTQQVIPMVKCIPHPDYNPKTFSNDIMLLKLKSKAKR
TRAVRPLNLPRRNVNVKPGDVCYVAGWGRMAPMGKYSNTLQEVELTVQKDRECESYFKNR
YNKTNQICAGDPKTKRASFRGDSGGPLVCKKVAAGIVSYGYKDGSPPRAFTKVSSFLSWI
KKTMKSS
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaagatcctcctgctactgctgaccttgtctctggcctccaggacaaaggcaggggag
atcatcgggggacatgaagtcaagccccactctcgaccctacatggccttactttcgatc
aaggatcagcagcctgaggcgatatgtgggggcttccttattcgagaggactttgtgctg
actgctgctcactgtgaaggaagtataataaatgtcactttgggggcccacaacatcaaa
gaacaggagaagacccagcaagtcatccctatggtaaaatgcattccccacccagactat
aatcctaagacattctccaatgacatcatgctgctaaagctgaagagtaaggccaagagg
actagagctgtgaggcccctcaacctgcccaggcgcaatgtcaatgtgaagccaggagat
gtgtgctatgtggctggttggggaaggatggccccaatgggcaaatactcaaacacgcta
caagaggttgagctgacagtacagaaggatcgggagtgtgagtcctactttaaaaatcgt
tacaacaaaaccaatcagatatgtgcgggggacccaaagaccaaacgtgcttcctttcgg
ggggattctggaggcccgcttgtgtgtaaaaaagtggctgcaggcatagtttcctatgga
tataaggatggttcacctccacgtgctttcaccaaagtctcgagtttcttatcctggata
aagaaaacaatgaaaagcagctaa

DBGET integrated database retrieval system