KEGG   Mus musculus (mouse): 14943
Entry
14943             CDS       T01002                                 

Symbol
Gzmf, CCP, CCP4, Ctl, Ctla, Ctla-7, Ctla7, MCSP, MCSP-3
Name
(RefSeq) granzyme F
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 14943
NCBI-ProteinID: NP_034504
MGI: 109254
Ensembl: ENSMUSG00000015441
UniProt: P08883 Q497Z7
Position
14 C3; 14 28.19 cM
AA seq 248 aa
MPPILILLTLLLPLRAGAEEIIGGHEVKPHSRPYMARVRFVKDNGKRHSCGGFLVQDYFV
LTAAHCTGSSMRVILGAHNIRAKEETQQIIPVAKAIPHPAYDDKDNTSDIMLLKLESKAK
RTKAVRPLKLPRPNARVKPGHVCSVAGWGRTSINATQRSSCLREAQLIIQKDKECKKYFY
KYFKTMQICAGDPKKIQSTYSGDSGGPLVCNNKAYGVLTYGLNRTIGPGVFTKVVHYLPW
ISRNMKLL
NT seq 747 nt   +upstreamnt  +downstreamnt
atgccaccaatcctgattctcctgacccttcttctgcctctcagagctggagcagaggag
atcatcgggggccatgaggtcaagccccactcccgcccttacatggcacgtgtgaggttt
gtgaaagataatggaaaaagacattcctgtggaggcttcctggttcaagactactttgtg
ctgacggctgctcactgcactggaagctcaatgagagtcatactgggggcccacaacatc
agggctaaggaagagacacagcagatcatccctgtggcaaaagccattccccacccagct
tatgatgataaggacaacaccagtgacatcatgctattaaagctggagagtaaggccaag
agaactaaagctgtgaggcccctcaagttgcccagacccaatgcccgggtgaagccaggg
catgtttgcagtgtggctggctgggggagaacatccatcaatgcaacacaaagatcttcc
tgcctacgagaggctcaactgatcatccagaaggataaggaatgcaaaaaatacttctat
aagtatttcaagaccatgcagatttgtgctggagacccaaagaaaatacagtctacttac
agtggtgactccgggggacccctcgtgtgtaacaacaaagcttatggagttttaacctat
gggctaaacaggacaatcggtccaggagtcttcactaaggttgtgcactacctgccgtgg
ataagcaggaacatgaagctgctctaa

DBGET integrated database retrieval system