KEGG   Mus musculus (mouse): 14945
Entry
14945             CDS       T01002                                 

Symbol
Gzmk
Name
(RefSeq) granzyme K
  KO
K08663  granzyme K [EC:3.4.21.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    14945 (Gzmk)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     14945 (Gzmk)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   14945 (Gzmk)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 DUF5445
Other DBs
NCBI-GeneID: 14945
NCBI-ProteinID: NP_032222
MGI: 1298232
Ensembl: ENSMUSG00000042385
Vega: OTTMUSG00000027683
UniProt: O35205
Position
13; 13 D2.2
AA seq 263 aa
MRFSSWALVSLVAGVYMSSECFHTEIIGGREVQPHSRPFMASIQYRSKHICGGVLIHPQW
VLTAAHCYSWFPRGHSPTVVLGAHSLSKNEPMKQTFEIKKFIPFSRLQSGSASHDIMLIK
LRTAAELNKNVQLLHLGSKNYLRDGTKCQVTGWGTTKPDLLTASDTLREVTVTIISRKRC
NSQSYYNHKPVITKDMICAGDARGQKDSCKGDSGGPLICKGIFHALVSQGYKCGIAKKPG
IYTLLTKKYQTWIKSKLAPSRAH
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaggttttcttcatgggctctggtttccctggtggctggcgtttatatgtcttcagag
tgtttccatactgaaattattggagggagggaagtccagccgcattccaggccatttatg
gcgtccatccagtaccgcagcaagcatatttgtggaggagtcctgatccacccacagtgg
gtgctaacagccgcccactgctactcttggtttcccagaggccactctcccaccgtggtt
ttaggagcacattctctttccaagaatgagcccatgaagcagacatttgaaattaaaaag
ttcatcccattctcacgacttcagtccggttccgcatcgcatgacatcatgctgataaag
cttcgcactgctgcagaactaaacaagaatgtccaactgcttcacctgggatccaaaaac
tatcttagagatgggaccaaatgccaggtgactggctggggaaccaccaagccagatctg
ttaaccgcctctgataccctgagagaagtcactgttaccatcataagtagaaaacgctgt
aacagccaaagctactacaaccacaaacctgttataaccaaggacatgatatgtgcagga
gatgccagaggtcaaaaggattcctgcaagggtgactctggtggccctttgatctgcaaa
ggcatcttccatgccctagtctctcagggctataaatgtggcatcgccaaaaagcctgga
atctatacgctattaactaagaaataccagacctggatcaaaagcaagcttgccccatca
cgtgcacattga

DBGET integrated database retrieval system