KEGG   Mus musculus (mouse): 14962
Entry
14962             CDS       T01002                                 

Gene name
Cfb, AI195813, AI255840, B, Bf, C2, Fb, H2-Bf
Definition
(RefSeq) complement factor B
  KO
K01335  complement factor B [EC:3.4.21.47]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    14962 (Cfb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    14962 (Cfb)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14962 (Cfb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    14962 (Cfb)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.47  alternative-complement-pathway C3/C5 convertase
     14962 (Cfb)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   14962 (Cfb)
SSDB
Motif
Pfam: VWA Sushi Trypsin VWA_2 HRM DUF1986
Other DBs
NCBI-GeneID: 14962
NCBI-ProteinID: NP_001136178
MGI: 105975
Ensembl: ENSMUSG00000090231
Vega: OTTMUSG00000034004
UniProt: B8JJM6
Position
17 B1; 17 18.41 cM
AA seq 713 aa
MTMESPQLCLVLLVLGFSSGGVSATPVLEARPQVSCSLEGVEIKGGSFQLLQGGQALEYL
CPSGFYPYPVQTRTCRSTGSWSDLQTRDQKIVQKAECRAIRCPRPQDFENGEFWPRSPFY
NLSDQISFQCYDGYVLRGSANRTCQENGRWDGQTAICDDGAGYCPNPGIPIGTRKVGSQY
RLEDIVTYHCSRGLVLRGSQKRKCQEGGSWSGTEPSCQDSFMYDSPQEVAEAFLSSLTET
IEGADAEDGHSPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGSSNFTGAKRCLTNLIEKVA
SYGVRPRYGLLTYATVPKVLVRVSDERSSDADWVTEKLNQISYEDHKLKSGTNTKRALQA
VYSMMSWAGDAPPEGWNRTRHVIIIMTDGLHNMGGNPVTVIQDIRALLDIGRDPKNPRED
YLDVYVFGVGPLVDSVNINALASKKDNEHHVFKVKDMEDLENVFYQMIDETKSLSLCGMV
WEHKKGNDYHKQPWQAKISVTRPLKGHETCMGAVVSEYFVLTAAHCFMVDDQKHSIKVSV
GGQRRDLEIEEVLFHPKYNINGKKAEGIPEFYDYDVALVKLKNKLKYGQTLRPICLPCTE
GTTRALRLPQTATCKQHKEQLLPVKDVKALFVSEQGKSLTRKEVYIKNGDKPVVREMLQR
PKAMRRSKMPLRWSLHGSSAQEGWIPMLTPTHAKEIPGALSLFTREAASFKLV
NT seq 2142 nt   +upstreamnt  +downstreamnt
atgacaatggagagcccccagctctgcctcgtcctcttggtcttaggcttctcctctgga
ggtgtgagcgcaactccagtgcttgaggcccggccccaagtctcctgctctctggaggga
gtagagatcaaaggcggctcctttcaacttctccaaggcggtcaggccctggagtaccta
tgtccctctggcttctacccataccccgtgcagactcgaacctgcagatccacaggctcc
tggagcgacctgcagacccgagaccaaaagattgtccagaaggcggaatgcagagcaata
cgctgcccacgaccgcaggactttgaaaatggggaattctggccccggtcccccttctac
aacctgagtgaccagatttcttttcaatgctatgatggttacgttctccggggctctgct
aatcgcacctgccaagagaatggccggtgggatgggcaaacagcaatttgtgatgatgga
gctggatactgtcccaatcccggtattcctattgggacaaggaaggtgggtagccaatac
cgccttgaagacattgttacttaccactgcagccggggacttgtcctgcgtggctcccag
aagcgaaagtgtcaagaaggtggctcatggagtgggacagagccttcctgccaagattcc
ttcatgtatgacagccctcaagaagtggccgaagcattcctatcctccctgacagagacc
atcgaaggagccgatgctgaggatgggcacagcccaggagaacagcagaagaggaagatt
gtcctagacccctcgggctccatgaatatctacctggtgctagatggatcagacagcatc
ggaagcagcaacttcacaggggctaagcggtgcctcaccaacttgattgagaaggtggcg
agttacggggtgaggccacgatatggtctcctgacatatgctacagtccccaaagtgttg
gtcagagtgtctgatgagaggagtagcgatgccgactgggtcacagagaagctcaaccaa
atcagttatgaagaccacaagctgaagtcagggaccaacaccaagagggctctccaggct
gtgtatagcatgatgagctgggcaggggatgccccgcctgaaggctggaatagaacccgc
catgtcatcatcattatgactgatggcttgcacaacatgggtggaaaccctgtcactgtc
attcaggacatccgagccttgctggacatcggcagggatcccaaaaatcccagggaggat
tacctggatgtgtatgtgtttggggtcgggcctctggtggactccgtgaacatcaatgcc
ttagcttccaaaaaggacaatgagcatcatgtgtttaaagtcaaggatatggaagacctg
gagaatgttttctaccaaatgattgatgaaaccaaatctctgagtctctgtggcatggtg
tgggagcataaaaaaggcaacgattatcataagcaaccatggcaagccaagatctcagtc
actcgccctctgaaaggacatgagacctgtatgggggccgtggtgtctgagtacttcgtg
ctgacagcagcgcactgcttcatggtggatgatcagaaacattccatcaaggtcagcgtg
gggggtcagaggcgggacctggagattgaagaggtcctgttccaccccaaatacaatatt
aatgggaaaaaggcagaagggatccctgagttctatgattatgatgtggccctagtcaag
ctcaagaacaagctcaagtatggccagactctcaggcccatctgtctcccctgcacggag
ggaaccacacgagccttgaggcttcctcagacagccacctgcaagcagcacaaggaacag
ttgctccctgtgaaggatgtcaaagctctgtttgtatctgagcaagggaagagcctgact
cggaaggaggtgtacatcaagaatggggacaagccagttgtgagagagatgctacaaagg
cccaaggctatgagaaggtcaaagatgcctctgaggtggtcactccacggttcctctgca
caggaggggtggatccctatgctgaccccaacacatgcaaaggagattccgggggccctc
tcattgttcacaagagaagccgcttcattcaagttggtgtga

DBGET integrated database retrieval system