KEGG   Mus musculus (mouse): 14972
Entry
14972             CDS       T01002                                 

Gene name
H2-K1, H-2K, H-2K(d), H2-D1, H2-K, H2-K_p, K-f
Definition
(RefSeq) histocompatibility 2, K1, K region
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14972 (H2-K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14972 (H2-K1)
   04145 Phagosome
    14972 (H2-K1)
  09143 Cell growth and death
   04218 Cellular senescence
    14972 (H2-K1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    14972 (H2-K1)
   04612 Antigen processing and presentation
    14972 (H2-K1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    14972 (H2-K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14972 (H2-K1)
   05170 Human immunodeficiency virus 1 infection
    14972 (H2-K1)
   05168 Herpes simplex virus 1 infection
    14972 (H2-K1)
   05163 Human cytomegalovirus infection
    14972 (H2-K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14972 (H2-K1)
   05169 Epstein-Barr virus infection
    14972 (H2-K1)
   05165 Human papillomavirus infection
    14972 (H2-K1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    14972 (H2-K1)
   05330 Allograft rejection
    14972 (H2-K1)
   05332 Graft-versus-host disease
    14972 (H2-K1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14972 (H2-K1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14972 (H2-K1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14972 (H2-K1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    14972 (H2-K1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14972 (H2-K1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  14972 (H2-K1)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig Ig_2 MHC_I_3 C2-set_2 HIG_1_N
Other DBs
NCBI-GeneID: 14972
NCBI-ProteinID: NP_001001892
MGI: 95904
Ensembl: ENSMUSG00000061232
Vega: OTTMUSG00000037104
UniProt: P01901 Q7JJ15
Structure
PDB: 

Position
17 B1; 17 17.98 cM
AA seq 369 aa
MVPCTLLLLLAAALAPTQTRAGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSD
AENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVIS
GCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAY
LEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQL
NGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPPS
TVSNMATVAVLVVLGAAIVTGAVVAFVMKMRRRNTGGKGGDYALAPGSQTSDLSLPDCKV
MVHDPHSLA
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggtaccgtgcacgctgctcctgctgttggcggccgccctggctccgactcagacccgc
gcgggcccacactcgctgaggtatttcgtcaccgccgtgtcccggcccggcctcggggag
ccccggtacatggaagtcggctacgtggacgacacggagttcgtgcgcttcgacagcgac
gcggagaatccgagatatgagccgcgggcgcggtggatggagcaggaggggcccgagtat
tgggagcgggagacacagaaagccaagggcaatgagcagagtttccgagtggacctgagg
accctgctcggctactacaaccagagcaagggcggctctcacactattcaggtgatctct
ggctgtgaagtggggtccgacgggcgactcctccgcgggtaccagcagtacgcctacgac
ggctgcgattacatcgccctgaacgaagacctgaaaacgtggacggcggcggacatggcg
gcgctgatcaccaaacacaagtgggagcaggctggtgaagcagagagactcagggcctac
ctggagggcacgtgcgtggagtggctccgcagatacctgaagaacgggaacgcgacgctg
ctgcgcacagattccccaaaggcccatgtgacccatcacagcagacctgaagataaagtc
accctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcagttg
aatggggaggagctgatccaggacatggagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagtattacacatgc
catgtgtaccatcaggggctgcctgagcccctcaccctgagatgggagcctcctccatcc
actgtctccaacatggcgaccgttgctgttctggttgtccttggagctgcaatagtcact
ggagctgtggtggcttttgtgatgaagatgagaaggagaaacacaggtggaaaaggaggg
gactatgctctggctccaggctcccagacctctgatctgtctctcccagattgtaaagtg
atggttcatgaccctcattctctagcgtga

DBGET integrated database retrieval system