KEGG   Mus musculus (mouse): 14979
Entry
14979             CDS       T01002                                 

Gene name
H2-Ke6, D17H6S112E, H-2Ke6, Hsd17b8, Ke-6, Ke6, Ri, Ring2
Definition
(RefSeq) H2-K region expressed gene 6
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00061  Fatty acid biosynthesis
mmu00140  Steroid hormone biosynthesis
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
Module
mmu_M00873  Fatty acid biosynthesis in mitochondria, animals
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    14979 (H2-Ke6)
   00140 Steroid hormone biosynthesis
    14979 (H2-Ke6)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     14979 (H2-Ke6)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     14979 (H2-Ke6)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase RmlD_sub_bind RNA_pol_Rpb1_4
Other DBs
NCBI-GeneID: 14979
NCBI-ProteinID: NP_038571
MGI: 95911
Ensembl: ENSMUSG00000073422
Vega: OTTMUSG00000035431
UniProt: P50171
Position
17 B1; 17 17.98 cM
AA seq 259 aa
MASQLRLRSALALVTGAGSGIGRAISVRLAAEGAAVAACDLDGAAAQDTVRLLGSPGSED
GAPRGKHAAFQADVSQGPAARRLLEEVQACFSRPPSVVVSCAGITRDEFLLHMSEEDWDR
VIAVNLKGTFLVTQAAAQALVSSGGRGSIINISSIIGKVGNIGQTNYASSKAGVIGLTQT
AARELGRHGIRCNSVLPGFIATPMTQKMPEKVKDKVTAMIPLGHMGDPEDVADVVAFLAS
EDSGYITGASVEVSGGLFM
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcgtctcagctccggctccgctctgcgctggccctggtcacaggtgcgggtagcggc
atcggccgtgcgatcagcgtgcgcctagcggcagagggcgccgccgtggccgcctgcgac
ctggacggggccgcggcacaggacacggtgcggctgctgggaagcccggggagcgaggac
ggggcgccgcgcggcaagcacgctgccttccaagcggatgtgtctcagggccccgcagcc
agacgcctgctggaggaagtgcaggcctgcttttctcgcccgccatctgtcgttgtgtcc
tgtgcgggcatcacacgcgatgagtttctgctccacatgtcagaagaagactgggacaga
gtcatagctgtcaacctcaagggcaccttcctagtcactcaggctgcagcccaggcttta
gtgtccagtggcggtcgtggctccatcatcaacattagtagcatcattggaaaggtgggg
aatatcggacaaacgaattatgcgtcgtccaaagcaggagtgattgggctcacccagact
gcggcccgggagcttggacgacatggaatccgatgtaactcggtcctcccagggttcatt
gcaacgcccatgacccagaaaatgccagagaaagtgaaggacaaggtaactgcaatgatt
ccgttgggacacatgggggaccctgaggatgtggcagatgtggttgcattcttggcatct
gaagacagtggatacatcacaggggcctccgtggaagtcagtggaggtcttttcatgtaa

DBGET integrated database retrieval system