KEGG   Mus musculus (mouse): 14990
Entry
14990             CDS       T01002                                 

Gene name
H2-M2, H-2M2, Thy19.4
Definition
(RefSeq) histocompatibility 2, M region locus 2
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    14990 (H2-M2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14990 (H2-M2)
   04145 Phagosome
    14990 (H2-M2)
  09143 Cell growth and death
   04218 Cellular senescence
    14990 (H2-M2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    14990 (H2-M2)
   04612 Antigen processing and presentation
    14990 (H2-M2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    14990 (H2-M2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14990 (H2-M2)
   05170 Human immunodeficiency virus 1 infection
    14990 (H2-M2)
   05168 Herpes simplex virus 1 infection
    14990 (H2-M2)
   05163 Human cytomegalovirus infection
    14990 (H2-M2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14990 (H2-M2)
   05169 Epstein-Barr virus infection
    14990 (H2-M2)
   05165 Human papillomavirus infection
    14990 (H2-M2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    14990 (H2-M2)
   05330 Allograft rejection
    14990 (H2-M2)
   05332 Graft-versus-host disease
    14990 (H2-M2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14990 (H2-M2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14990 (H2-M2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14990 (H2-M2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    14990 (H2-M2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14990 (H2-M2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  14990 (H2-M2)
SSDB
Motif
Pfam: MHC_I C1-set ig
Other DBs
NCBI-GeneID: 14990
NCBI-ProteinID: NP_001334316
MGI: 95914
Ensembl: ENSMUSG00000016283
Vega: OTTMUSG00000037432
UniProt: Q6W9L1
Position
17 B1; 17 19.16 cM
AA seq 343 aa
METSAFFTLLFTLYLLLGASLALAQTFKGSHSLRYFDIAVSRPGLEETHYMTVGYVDDTE
FVHFDNEAENPRFEPRVPWMEQMGQKYWDDQTRIAKAAEQQIRVYFQKLRDYYNQSQNSS
HTIQRMTGCYIGPDGHLLHAYRQFGYDGQDYLTLNEDLSTWTAADAAAEITRREWEATNV
AEFWRVYLEGPCMVWLFKYLTVGNETLLRTEPPKAYVTHHPRPEGDVTLRCWALGFYPSD
IIMIWQRDGEDQTQDMDVIETRPAGDGTFQKWVAVVVPSGKEQNYTCHVAHEGLPEPLTL
RWSRPPQSFIFIIIVAVGLVLLGASVATLVMWKKSSGGERGSL
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggagacttcagcattcttcactctcctcttcactctctacctgctgcttggggcttcc
cttgccctggcacagacctttaaaggatcccactccttgcggtacttcgacatcgcagtg
tcaagacctggcctagaggagacccactacatgactgttggctatgtggatgacacagag
tttgtgcattttgacaatgaggctgagaatccgaggtttgagccccgagtgccttggatg
gaacagatgggacagaagtactgggatgaccagacacgcattgcgaaagctgcagaacag
cagattagagtgtactttcagaaactgcgagactactacaaccagagccagaacagttct
cacaccatccaaaggatgactggctgctacattggaccagacgggcacctacttcacgca
taccgtcagtttggttatgatgggcaagattacctcactctgaatgaagatctgagcacc
tggactgcagcagatgcggcagctgagatcacccgtagagagtgggaggcaactaatgtg
gctgagttctggagggtctacttggagggcccttgcatggtgtggctctttaaatacctg
acagtgggaaatgagactctactgcgcacagagcccccaaaggcatatgtgacccatcac
cccagacctgaaggtgatgtcaccctgaggtgctgggccctgggtttctacccttctgac
atcatcatgatctggcaaagagatggggaggaccagacccaggacatggatgttattgag
accagacctgcaggggatggaaccttccagaagtgggtagctgtggtggtgccttctggg
aaggagcagaattacacatgccatgtggctcatgagggactgcctgagcccctcaccctg
agatggagtagacctcctcagtctttcattttcatcataatagttgctgttggcctggtt
ctcctgggagcttcagtggctactcttgtcatgtggaagaagagctcgggtggggaaagg
ggcagcctctga

DBGET integrated database retrieval system