KEGG   Mus musculus (mouse): 14999
Entry
14999             CDS       T01002                                 

Gene name
H2-DMb1, AI385589, H-2Mb1, H2-Mb1
Definition
(RefSeq) histocompatibility 2, class II, locus Mb1
  KO
K06752  MHC class II antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04514  Cell adhesion molecules (CAMs)
mmu04612  Antigen processing and presentation
mmu04640  Hematopoietic cell lineage
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04672  Intestinal immune network for IgA production
mmu04940  Type I diabetes mellitus
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05310  Asthma
mmu05320  Autoimmune thyroid disease
mmu05321  Inflammatory bowel disease (IBD)
mmu05322  Systemic lupus erythematosus
mmu05323  Rheumatoid arthritis
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    14999 (H2-DMb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    14999 (H2-DMb1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14999 (H2-DMb1)
   04612 Antigen processing and presentation
    14999 (H2-DMb1)
   04658 Th1 and Th2 cell differentiation
    14999 (H2-DMb1)
   04659 Th17 cell differentiation
    14999 (H2-DMb1)
   04672 Intestinal immune network for IgA production
    14999 (H2-DMb1)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    14999 (H2-DMb1)
   05322 Systemic lupus erythematosus
    14999 (H2-DMb1)
   05323 Rheumatoid arthritis
    14999 (H2-DMb1)
   05320 Autoimmune thyroid disease
    14999 (H2-DMb1)
   05321 Inflammatory bowel disease (IBD)
    14999 (H2-DMb1)
   05330 Allograft rejection
    14999 (H2-DMb1)
   05332 Graft-versus-host disease
    14999 (H2-DMb1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14999 (H2-DMb1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    14999 (H2-DMb1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14999 (H2-DMb1)
   05152 Tuberculosis
    14999 (H2-DMb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14999 (H2-DMb1)
   05164 Influenza A
    14999 (H2-DMb1)
   05168 Herpes simplex virus 1 infection
    14999 (H2-DMb1)
   05169 Epstein-Barr virus infection
    14999 (H2-DMb1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    14999 (H2-DMb1)
   05140 Leishmaniasis
    14999 (H2-DMb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14999 (H2-DMb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   14999 (H2-DMb1)
  Exosomal proteins of epithelial cells
   14999 (H2-DMb1)
  Exosomal proteins of breast milk
   14999 (H2-DMb1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_2 Ig_3 C2-set_2 I-set ig
Other DBs
NCBI-GeneID: 14999
NCBI-ProteinID: NP_034517
MGI: 95922
Ensembl: ENSMUSG00000079547
Vega: OTTMUSG00000037116
UniProt: Q31094
Position
17 B1; 17 17.98 cM
AA seq 261 aa
MAALWLLLLVLSLDCMGAGGFVAHVESTCVLDDAGTPQDFTYCVSFNKDLLACWDPDVGK
IVPCEFGVLYPWAENFSRILNKEESLLQRLQNGLLDCASHTQPFWNALTHRTRAPSVRVA
QTTPFNTREPVMLACYVWGFYPADVTITWMKNGQLVPSHSNKEKTAQPNGDWTYQTVSYL
ALTPSYGDVYTCVVQHSGTSEPIRGDWTPGLSPIQTVKVSVSAATLGLGFIIFCVGFFRW
RKSHSSSYTPLSGSTYPEGQH
NT seq 786 nt   +upstreamnt  +downstreamnt
atggctgcactctggctgctgctgctggtcctcagtctggactgtatgggggcaggtggc
tttgtggctcatgtggaaagcacgtgcgtgctggatgatgctgggaccccacaggacttc
acatactgtgtttccttcaacaaagatctgctggcctgctgggatccagatgtgggaaaa
atagtcccctgtgaatttggggtgctgtatccatgggccgaaaatttttcaaggatcctc
aacaaagaagagagccttctccagcgtttgcaaaacgggcttctggactgtgcctcccac
acccagcccttctggaatgcgctgacccacagaacgagagcgccatctgtccgagtagcc
caaaccacaccttttaacacaagggagccggtgatgctggcctgctacgtctggggcttc
tatccagcggatgtgaccatcacatggatgaagaatgggcagcttgtcccttcccacagc
aacaaggagaagacggctcagcccaatggagactggacataccagacagtctcctaccta
gccctaaccccttcctacggggacgtctacacctgcgtggttcagcacagcgggacctct
gagcccatccgaggggactggacacctgggctgtcccccatccagacagtgaaggtctct
gtgtctgcagccaccctgggcctgggcttcatcatcttctgtgttggcttcttcagatgg
cgcaagtctcattcctccagctacactcctctctctggatccacctacccggaaggacag
cattag

DBGET integrated database retrieval system