KEGG   Mus musculus (mouse): 15013
Entry
15013             CDS       T01002                                 

Gene name
H2-Q2, BE136769, Gm11132, H-2Q2, H2-D1, H2-K1, gs14-2
Definition
(RefSeq) histocompatibility 2, Q region locus 2
  KO
K06751  MHC class I antigen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04145  Phagosome
mmu04218  Cellular senescence
mmu04514  Cell adhesion molecules
mmu04612  Antigen processing and presentation
mmu04940  Type I diabetes mellitus
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05320  Autoimmune thyroid disease
mmu05330  Allograft rejection
mmu05332  Graft-versus-host disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    15013 (H2-Q2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    15013 (H2-Q2)
   04145 Phagosome
    15013 (H2-Q2)
  09143 Cell growth and death
   04218 Cellular senescence
    15013 (H2-Q2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15013 (H2-Q2)
   04612 Antigen processing and presentation
    15013 (H2-Q2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    15013 (H2-Q2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    15013 (H2-Q2)
   05170 Human immunodeficiency virus 1 infection
    15013 (H2-Q2)
   05168 Herpes simplex virus 1 infection
    15013 (H2-Q2)
   05163 Human cytomegalovirus infection
    15013 (H2-Q2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    15013 (H2-Q2)
   05169 Epstein-Barr virus infection
    15013 (H2-Q2)
   05165 Human papillomavirus infection
    15013 (H2-Q2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    15013 (H2-Q2)
   05330 Allograft rejection
    15013 (H2-Q2)
   05332 Graft-versus-host disease
    15013 (H2-Q2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    15013 (H2-Q2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    15013 (H2-Q2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15013 (H2-Q2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    15013 (H2-Q2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   15013 (H2-Q2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Antigens
  15013 (H2-Q2)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Psg1
Other DBs
NCBI-GeneID: 15013
NCBI-ProteinID: NP_001355669
MGI: 95931
Ensembl: ENSMUSG00000091705
Vega: OTTMUSG00000037101
Position
17 B1; 17 18.64 cM
AA seq 346 aa
MALRRLLLLLVAALKLTETRAGSHSLRYFTTAVSRPGLGEPRFIIVGYVDDTQFVRFDSD
AENPRMEPRAPWMEQEGPEYWERNTQVSKENEQSFRVSLGTALSYYNQSKGGSHTLQWLV
GCDLGPDGSLLRGYEQSAYDGRDYLALNEDLITWTAADLAALKTRSKLEQAGLAEKRRAY
LEVDCLTWLRRYLELGKETLLHTDPPKAHVTHHPSSQGDVTLRCWALGFYPADITLTWQL
NGEDLTQDMELVETRPSGDGTFQKWASVMVPFGEEPRYTCHVEHEGLPEPLTLRWEPPPS
TDSYMVIIAVLVVLGAVIIIGAVVAFVMKRGRNTGGKVRDYAQDPA
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggcgctgcgaaggctgctcctgctgttggtggccgccctgaaactgactgagacacgc
gcgggctcacactcgctgcggtatttcaccaccgccgtgtcccggcctggcctcggggag
ccccggttcattatcgtcggctacgtggacgacacgcagttcgtgcgcttcgacagcgac
gcggagaatccgaggatggagccgcgggcgccgtggatggagcaggaggggccggagtat
tgggagcggaacacacaggtctccaaggaaaatgagcagagtttccgagtgagcctgggg
accgcactgagctactacaaccagagcaagggaggctctcacactctccagtggttggtt
ggctgtgacctggggccagacggaagcctactccgagggtatgagcagtctgcctacgat
ggccgcgattacctcgccctgaatgaggatctgataacgtggacagcggcggacctggca
gcactgaagacccgaagcaagttggagcaggctggtcttgcagagaagcgcagggcctac
ctggaggtcgattgcttgacgtggctccgcagatacctggagctcgggaaggagacgctg
ctgcacacagatcccccaaaggcgcatgtgacccatcaccccagttctcaaggtgatgtc
accctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcagttg
aatggggaggacctgacccaggacatggagcttgtggagaccaggccttcaggggatgga
accttccagaagtgggcatctgtgatggtgccttttggggaggagcctagatacacatgc
catgtggaacatgaggggctgcctgagcccctcaccctgagatgggagcctcctccatcc
actgactcttacatggtgatcattgctgttctggttgtccttggagctgtgatcatcatt
ggagctgtggtggcttttgtgatgaaaagagggagaaacacaggtggaaaagtaagagac
tacgctcaagatccagcatga

DBGET integrated database retrieval system