KEGG   Mus musculus (mouse): 15061
Entry
15061             CDS       T01002                                 

Gene name
Ifi44l, H-28, H28, H28-1, NS11, NS1178
Definition
(RefSeq) interferon-induced protein 44 like
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: TLD
Other DBs
NCBI-GeneID: 15061
NCBI-ProteinID: NP_112735
MGI: 95975
Ensembl: ENSMUSG00000039146
Vega: OTTMUSG00000053619
UniProt: Q9BDB7
Position
3 H3; 3 76.94 cM
AA seq 449 aa
MKVTARLTWIEEKILEKLLGNASLTLLYQSSAHKNCVSEMTQKYSLQGSTMTVFHLEKDV
VVGVFILENFPRLVSEKPCTCAWFSLKRNNSSGISALFLNTKVIVDSEELIIFSLDGLSL
SVTPLRGFTLALNDTVMNGLELNLGHGFLPVECEIFRVDGIKKNPSFIKKMVTAEQHRGK
LLSALRAYKPYKDLVSEGSYSLGGPSRLRESRAFSTQWKSAFQGHLTRQAHCGGSDESSI
TKQYRVYSIKDGKSGETLPFMLCDSMGLEEGEEAGLCIDDIPHILQGCVPDRYQFNPCEP
MKPKHSPHAASPPLKDRIHCVAFVLHINSVNTLSDKMVAKLKKIRKDVVDCGIGYVALLT
NVEEYDEVLDDSFANMTETVTSLSQVQNVQKWLNIPIANILMVSNYASERRLEPMKDILV
FAALRQMLRAADDALEDLLLEDTGNLAPF
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaaagtgacagccagattgacatggatagaagagaagattctggaaaagctgcttggg
aacgcatcattgactcttctttatcagtccagtgctcataaaaattgtgtttctgagatg
actcagaaatattctcttcagggatccacaatgacagtatttcacctagagaaagatgtt
gttgtgggtgtttttatactggagaattttcctaggttagtctctgaaaagccatgtact
tgtgcgtggttttcattaaaaaggaataatagttctggaatatcagctttgtttttgaac
acaaaagtaatagttgactctgaagagctgataattttctcactcgatggtttgtcactc
agtgtgactccacttagaggcttcacacttgctctaaatgatacagtaatgaacggtcta
gaactcaatcttggacatggctttctacctgtggaatgtgaaatctttcgagttgatggc
attaagaaaaatccaagcttcataaagaagatggtgaccgccgaacagcaccgaggaaaa
ttactctctgctctcagagcctacaagccttataaggacctggtttcagaaggttcgtat
tctcttggtgggcccagtaggctcagggaaagtcgagctttttcaactcagtggaagtct
gctttccaaggccacctaactcgccaggcccattgtggggggtctgacgaaagcagtatc
accaagcagtacagagtttattctattaaagatggaaaaagcggggaaacactcccattt
atgctgtgtgattcaatggggctggaggagggggaggaagccgggctgtgcatagatgac
attcctcatatcttacaaggctgtgtaccagacaggtatcagttcaacccctgtgagccg
atgaagccgaagcactcccctcacgccgcctctccgcccctgaaggacaggattcactgc
gtggcttttgtcctacacatcaactctgttaatacactatctgataaaatggtggcaaag
ctgaaaaaaattcgcaaagatgtagtagactgtggtataggatatgtagccttgcttaca
aatgtggaggagtatgatgaagttcttgatgacagttttgcaaacatgacagaaactgtg
acttctctaagccaggttcagaatgtccaaaaatggctaaatattcctatagccaatatc
ttgatggtcagcaattatgcttcagagcgaaggttggagcctatgaaggatattctggtc
tttgctgctctcaggcagatgttgagggctgcggatgatgccttagaggacttgcttctc
gaggatactggtaacctggctcctttctaa

DBGET integrated database retrieval system