KEGG   Mus musculus (mouse): 15081
Entry
15081             CDS       T01002                                 

Gene name
H3f3b, 9430068D06Rik, H3-3a, H3-3b, H3.3B
Definition
(RefSeq) H3.3 histone B
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    15081 (H3f3b)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    15081 (H3f3b)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    15081 (H3f3b)
  09165 Substance dependence
   05034 Alcoholism
    15081 (H3f3b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    15081 (H3f3b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15081 (H3f3b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    15081 (H3f3b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   15081 (H3f3b)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 15081
NCBI-ProteinID: NP_032237
MGI: 1101768
Ensembl: ENSMUSG00000016559
Vega: OTTMUSG00000003689
UniProt: P84244
Structure
PDB: 
5XM0 5XM1

Position
11; 11 E2
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgaaccaagcagaccgctaggaagtccaccggtgggaaagccccccgcaaacag
ctggccaccaaggcggctcggaaaagcgcgccctctaccggcggggtgaagaagcctcac
cgctacaggccagggaccgtggctctgagagagatccgtcgttaccagaaatcgactgag
ctgctcatccggaagctgccattccagagattggtgagggagatcgcccaggatttcaaa
accgacttgaggtttcaaagtgcagccatcggtgcccttcaggaggctagcgaagcatac
ctggtggggttgtttgaagataccaatctgtgtgccatccacgccaagagagtcaccatc
atgcccaaagacatccagttggctcgccggatacggggggagagagcttaa

DBGET integrated database retrieval system