KEGG   Mus musculus (mouse): 15101
Entry
15101             CDS       T01002                                 

Gene name
H60a, H60
Definition
(RefSeq) histocompatibility 60a
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    15101 (H60a)
SSDB
Motif
Pfam: MHC_I_2 Tmemb_9 ABC2_membrane_3 DUF4064 ATP-synt_I VanZ
Other DBs
NCBI-GeneID: 15101
NCBI-ProteinID: NP_034530
MGI: 1306817
UniProt: Q3TDZ7
Position
10
AA seq 262 aa
MAKGATSKSNHCLILSLFILLSYLGTILADGTDSLSCELTFNYRNLHGQCSVNGKTLLDF
GDKKHEENATKMCADLSQNLREISEEMWKLQSGNDTLNVTTQSQYNQGKFIDGFWAINTD
EQHSIYFYPLNMTWRESHSDNSSAMEQWKNKNLEKDMRNFLITYFSHCLNKSSSHFREMP
KSTLKVPDTTQRTNATQIHPTVNNFRHNSDNQGLSVTWIVIICIGGLVSFMAFMVFAWCM
LKKKKKRCSLLLLFFCSPHYQL
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcaaagggagccaccagcaagagcaaccattgcctgattctgagccttttcattctg
ctgagctatctggggaccatactggcagatggtacagactctctaagttgtgaattaact
ttcaactatcgtaatctacatggacagtgctcagtgaatggaaagactctccttgatttt
ggtgataaaaaacatgaggaaaatgctactaagatgtgtgctgatttgtcccaaaacctg
agagagatttcagaagagatgtggaagttacaatcaggtaatgataccttgaatgtcaca
acacaatctcagtataatcaaggaaaattcattgatggattctgggccatcaacactgat
gaacagcatagcatctacttttatccacttaatatgacctggagagaaagtcattctgat
aacagcagtgccatggagcagtggaagaacaagaacctagagaaagatatgaggaatttc
ctcatcacatatttcagtcactgcctcaacaaatcgtcatcacactttagagaaatgcca
aaatcaacattaaaggtgccggataccacccaacgtacaaatgccactcagattcatcct
acagtgaataacttccgacataattctgacaaccagggtctgagtgtcacctggattgtg
attatatgtataggaggattagtgtctttcatggcattcatggtattcgcttggtgtatg
ctgaagaaaaaaaaaaaaaggtgctccctgctgctcctcttcttctgcagtcctcattac
cagctataa

DBGET integrated database retrieval system