KEGG   Mus musculus (mouse): 15108
Entry
15108             CDS       T01002                                 

Gene name
Hsd17b10, 17bHSD10, Ad, Ads9, ER, ERAB, Hadh, Hadh2, MHBD
Definition
(RefSeq) hydroxysteroid (17-beta) dehydrogenase 10
  KO
K08683  3-hydroxyacyl-CoA dehydrogenase / 3-hydroxy-2-methylbutyryl-CoA dehydrogenase [EC:1.1.1.35 1.1.1.178]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00280  Valine, leucine and isoleucine degradation
mmu01100  Metabolic pathways
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    15108 (Hsd17b10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    15108 (Hsd17b10)
   05022 Pathways of neurodegeneration - multiple diseases
    15108 (Hsd17b10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    15108 (Hsd17b10)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15108 (Hsd17b10)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     15108 (Hsd17b10)
    1.1.1.178  3-hydroxy-2-methylbutyryl-CoA dehydrogenase
     15108 (Hsd17b10)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial ribonuclease P
    15108 (Hsd17b10)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   15108 (Hsd17b10)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Ribosomal_L12
Other DBs
NCBI-GeneID: 15108
NCBI-ProteinID: NP_058043
MGI: 1333871
Ensembl: ENSMUSG00000025260
Vega: OTTMUSG00000019648
UniProt: Q99N15
Position
X; X F3
AA seq 261 aa
MAAAVRSVKGLVAVVTGGASGLGLATAKRLVGQGATAVLLDVPDSEGEAQAKKLGESCIF
APANVTSEKEIQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHQKKNKIHTLEDFQRVINV
NLIGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTL
PIARDLAPTGIRVVTIAPGLFATPLLTTLPEKVRNFLASQVPFPSRLGDPAEYAHLVQTI
IENPFLNGEVIRLDGAIRMQP
NT seq 786 nt   +upstreamnt  +downstreamnt
atggctgcggcagttcggagcgtgaagggcttggtcgcggtagtaactggaggagcctcg
ggccttggcctagctacggccaaaagactggtgggacaaggggccacagctgtacttctg
gatgtacctgactcagagggtgaagcccaagccaagaagttaggagaaagctgcatattt
gccccagcaaatgtgacctctgagaaggagatacaagcagctttgactctagcaaaagaa
aagtttggccgtatagatgtggctgtcaactgtgcaggtattgcagtggccattaagaca
taccaccaaaagaagaacaagatccatactttggaggacttccagcgggttatcaatgtg
aatcttataggcactttcaatgtgatccgcctggttgctggggagatgggccagaatgaa
ccagaccagggaggccaacgtggagttatcattaacactgccagtgtggctgcctttgag
ggccaggttggacaagctgcatactctgcatccaaagggggcatagtgggcatgacactg
cccattgctcgagatctggctcctacaggcatccgtgtggtaacaattgctccaggtttg
tttgccaccccactgcttaccacccttccagagaaagtgcgaaacttcttggccagccag
gtacccttccccagccgactaggtgaccccgctgaatatgctcatctggtacagaccata
atcgagaacccattcttgaatggagaggtcatccggctggatggggccattcgaatgcag
ccttaa

DBGET integrated database retrieval system