KEGG   Mus musculus (mouse): 15109
Entry
15109             CDS       T01002                                 

Gene name
Hal, Hs, Hsd, his, hist, histidase
Definition
(RefSeq) histidine ammonia lyase
  KO
K01745  histidine ammonia-lyase [EC:4.3.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00340  Histidine metabolism
mmu01100  Metabolic pathways
Module
mmu_M00045  Histidine degradation, histidine => N-formiminoglutamate => glutamate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    15109 (Hal)
Enzymes [BR:mmu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.3  histidine ammonia-lyase
     15109 (Hal)
SSDB
Motif
Pfam: Lyase_aromatic Par3_HAL_N_term
Other DBs
NCBI-GeneID: 15109
NCBI-ProteinID: NP_034531
MGI: 96010
Ensembl: ENSMUSG00000020017
Vega: OTTMUSG00000030965
UniProt: P35492 Q8CE60 B2RXW1
Position
10 C2; 10 48.49 cM
AA seq 657 aa
MPRYTVHVRGEWLAVPCQDGKLTVGWLGREAVRRYMKNKPDNGGFTSVDEVQFLVHRCKG
LGLLDNEDELEVALEDNEFVEVVIEGDVMSPDFIPSQPEGVFLYSKYREPEKYIALDGDS
LSTEDLVNLGKGRYKIKLTSIAEKKVQQSREVIDSIIKERTVVYGITTGFGKFARTVIPA
NKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLETLKQVIEAFNAS
CLSYVPEKGTVGASGDLAPLSHLALGLIGEGKMWSPKSGWADAKYVLEAHGLKPIVLKPK
EGLALINGTQMITSLGCEALERASAIARQADIVAALTLEVLKGTTKAFDTDIHAVRPHRG
QIEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTIAFVKDIITT
ELNSATDNPMVFASRGETISGGNFHGEYPAKALDYLAIGVHELAAISERRIERLCNPSLS
ELPAFLVAEGGLNSGFMIAHCTAAALVSESKALCHPSSVDSLSTSAATEDHVSMGGWAAR
KALRVVEHVEQVLAIELLAACQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDI
EAAHRLLLDQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLESLRKNSATIPESDDL
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgcctaggtacacagtgcacgtgcgtggggaatggctggcggtgccctgtcaggatggg
aagctcactgttggctggctgggccgtgaggctgtgcgacgctacatgaagaacaaaccg
gacaatggtggcttcacttcggtggatgaagtgcaattccttgtgcatcggtgcaagggc
ctgggcctgctggacaatgaggacgagctggaggtggccttagaggacaatgagttcgta
gaagtggtgattgaaggtgatgtgatgtctcctgatttcattccgtcgcagccagaagga
gttttcctatacagcaaataccgggagcctgaaaaatacattgccctagatggggacagt
ctgagcacagaggatctggtcaacctgggcaagggacgttacaagataaagctcacttca
attgctgagaagaaagtgcagcagtcccgggaggtcatcgacagcatcatcaaagaaaga
acagttgtttatggcatcaccacaggttttggaaaatttgctagaactgtaatccctgcc
aataagctacaggagcttcaagtcaacttagtccgttcccattcttcaggtgttgggaaa
ccactcagtcctgagaggtgtcggatgctcttggctttgaggatcaacgtcttagccaaa
ggttacagtgggatttccttggagacgctgaaacaagttattgaagcatttaatgcctcc
tgcctgtcctatgttccagagaaaggaactgtgggtgccagcggagaccttgccccactc
tctcatcttgctctggggctcatcggagaaggaaagatgtggtccccgaagagtggctgg
gcagatgctaaatatgttctagaagcccatggactgaaaccaattgtcttgaaaccaaaa
gaaggcctggcactcatcaatgggacacagatgatcacttccctgggctgtgaagccctg
gagcgagccagcgccattgcccggcaagctgatattgtggctgccttgaccctggaggtg
ctgaagggcaccaccaaagccttcgataccgacatccatgctgtccgacctcaccgtggg
caaattgaagttgctttccgattccggtccctcctggactcggatcaccacccatcagaa
atcgcagaaagccacaggttctgcgatcgtgttcaggacgcgtacaccttacgctgctgt
ccacaggtccacggtgtggtgaacgacacaatagcctttgtgaaggacatcatcactaca
gaactgaacagcgccacagacaatcctatggtctttgccagtcgaggggagacaatttca
ggaggaaacttccatggtgaatacccagccaaagccctggactatttggccattggtgtc
catgaacttgcggcaattagtgaaagaagaatcgaaaggctgtgtaatccttccctcagc
gagctgcctgccttcctggtggctgaaggaggtctcaattctgggttcatgatagcccac
tgcaccgcagcagccctggtgtctgagagcaaggctctgtgccacccttcatctgtggac
tcactctcgaccagtgctgctacagaagaccacgtctccatgggaggatgggcagccagg
aaagccctcagggtcgtcgagcacgtggaacaagtgctagccattgagcttctcgcggcc
tgccagggtatagagtttctgcgccccctgaaaacaaccactccgctggagaaggtgtac
gacctggtgcgctccgtagtaaggccctggataaaagatcgcttcatggccccggacatt
gaggcagcacacaggttgcttcttgaccaaaaggtttgggaggttgccgcaccgtacatc
gagaaatacagaatggagcacattccggaatccagaccgctttctccaacagcgttttca
ctagaatctctccgaaagaactcagccacaatcccagagtctgacgatctttaa

DBGET integrated database retrieval system