KEGG   Mus musculus (mouse): 15114
Entry
15114             CDS       T01002                                 

Symbol
Hap1, HAP, HAP-1
Name
(RefSeq) huntingtin-associated protein 1
  KO
K04647  huntingtin-associated protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04727  GABAergic synapse
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    15114 (Hap1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    15114 (Hap1)
   05016 Huntington disease
    15114 (Hap1)
   05022 Pathways of neurodegeneration - multiple diseases
    15114 (Hap1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    15114 (Hap1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    15114 (Hap1)
SSDB
Motif
Pfam: HAP1_N bZIP_1
Other DBs
NCBI-GeneID: 15114
NCBI-ProteinID: NP_817090
MGI: 1261831
Ensembl: ENSMUSG00000006930
Vega: OTTMUSG00000006280
UniProt: O35668
Position
11 63.47 cM; 11 D
AA seq 628 aa
MRPKEQVQSGAGDGTGSGDPAAGTPTTQPAVGPAPEPSAEPKPAPAQGTGSGQKSGSRTK
TGSFCRSMIIGDSDAPWTRYVFQGPYGPRATGLGTGKAEGIWKTPAAYIGRRPGVSGPER
AAFIRELQEALCPNPPPTKKITEDDVKVMLYLLEEKERDLNTAARIGQSLVKQNSVLMEE
NNKLETMLGSAREEILHLRKQVNLRDDLLQLYSDSDDDDDEEDEEDEEEGEEEEREGQRD
QDQQHDHPYGAPKPHPKAETAHRCPQLETLQQKLRLLEEENDHLREEASHLDNLEDEEQM
LILECVEQFSEASQQMAELSEVLVLRLEGYERQQKEITQLQAEITKLQQRCQSYGAQTEK
LQQMLASEKGIHSESLRAGSYMQDYGSRPRDRQEDGKSHRQRSSMPAGSVTHYGYSVPLD
ALPSFPETLAEELRTSLRKFITDPAYFMERRDTHCREGRKKEQRAMPPPPAQDLKPPEDF
EAPEELVPEEELGAIEEVGTAEDGQAEENEQASEETEAWEEVEPEVDETTRMNVVVSALE
ASGLGPSHLDMKYVLQQLSNWQDAHSKRQQKQKVVPKDSPTPQQQTNMGGGILEQQPRVP
TQDSQRLEEDRATHSPSAREEEGPSGAT
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgcgcccgaaagagcaggtgcagagcggtgcgggagacgggacagggtcgggggaccca
gcagcaggcacccccacgacccagcctgcagttggtcccgctccggagccctcggcggag
cccaaacctgctccagcgcagggaaccgggtccggacaaaaatcaggatcccgaaccaag
acaggaagcttttgtcggtccatgatcattggtgattcggacgcaccatggacccgctac
gtattccaggggccttacggtccccgggccactggcctgggcactggaaaggccgaggga
atctggaagacaccagccgcgtacatcggccggaggcccggcgtgtccggccctgagcgt
gcggcgtttattcgagagctgcaggaagcgttgtgtcctaatccaccacccacgaagaag
atcaccgaagatgatgtcaaagtgatgttgtatttgctggaagagaaagaacgggacctg
aacacagccgcccggatcggccagtccctggtgaaacagaacagtgtcttgatggaggag
aataataagctggaaaccatgctgggctcagccagggaggagattttacatctccggaag
caggtgaacctgcgagatgaccttcttcagctctactcagactctgatgacgatgatgat
gaggaagacgaggaagacgaggaagagggcgaagaggaggaacgagaaggacagagggat
caagaccagcagcacgaccacccctatggtgcccccaagccacaccctaaggctgagaca
gcgcaccgctgcccacagctggaaaccctgcagcagaagctcaggcttctggaggaagag
aacgaccacctgcgagaggaggcctcccaccttgacaacctggaggacgaagagcagatg
ctcattctggaatgtgtggagcagttctctgaagccagccagcagatggcagagctatcg
gaagtgctggtgttgaggctggaaggctatgagaggcagcagaaagagatcactcagctg
caggccgagatcaccaagctacaacagcgttgtcagtcttatggggcccagacagagaaa
ctgcagcagatgctggcctcagagaaggggatccactcggagagcctgcgagctggctcc
tacatgcaggattatgggagcaggcctcgtgaccgccaggaggatgggaagagtcatcgc
cagcgctcctccatgcccgcaggctctgtcacccactatggatacagtgtgcctctggat
gcacttccaagtttcccagagacactggctgaggagctccgaacatctctgaggaagttc
atcactgaccctgcgtatttcatggagagacgtgacactcactgcagggaggggcggaag
aaggagcagagggcgatgccacccccaccggctcaagatctcaagccacctgaagatttt
gaggctccagaggagttggttcctgaggaggagctgggggccatcgaagaggtggggaca
gctgaggatgggcaggcagaagagaacgagcaggcgtctgaggagaccgaggcctgggag
gaggtggaaccggaggtggacgagaccacaaggatgaatgtggtggtctccgccctggag
gccagtggcctgggcccttcccacctggacatgaagtatgtcctccagcaactgtccaac
tggcaggacgcccactctaagcggcagcagaagcagaaggtggtcccaaaagactcccca
accccgcagcagcaaacaaacatggggggcgggatcctggagcagcagcccagagtgccg
acccaggactctcagaggctggaggaggacagggccactcactctcccagtgccagggag
gaagaggggccttctggggccacctag

DBGET integrated database retrieval system