KEGG   Mus musculus (mouse): 15122Help
Entry
15122             CDS       T01002                                 

Gene name
Hba-a1, Hba, Hba1, Hbat1
Definition
(RefSeq) hemoglobin alpha, adult chain 1
  KO
K13822  hemoglobin subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05143  African trypanosomiasis
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious diseases: Parasitic
   05144 Malaria
    15122 (Hba-a1)
   05143 African trypanosomiasis
    15122 (Hba-a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    15122 (Hba-a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   15122 (Hba-a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Globin
Motif
Other DBs
NCBI-GeneID: 15122
NCBI-ProteinID: NP_032244
MGI: 96015
Ensembl: ENSMUSG00000069919
Vega: OTTMUSG00000005377
UniProt: Q91VB8
Structure
PDB: 

Position
11 A4; 11 18.86 cM
AA seq 142 aa AA seqDB search
MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHG
KKVADALANAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTP
AVHASLDKFLASVSTVLTSKYR
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctctggggaagacaaaagcaacatcaaggctgcctgggggaagattggtggc
catggtgctgaatatggagctgaagccctggaaaggatgtttgctagcttccccaccacc
aagacctacttccctcactttgatgtaagccacggctctgcccaggtcaagggtcacggc
aagaaggtcgccgatgctctggccaatgctgcaggccacctcgatgacctgcccggtgcc
ctgtctgctctgagcgacctgcatgcccacaagctgcgtgtggatcccgtcaacttcaag
ctcctgagccactgcctgctggtgaccttggctagccaccaccctgccgatttcaccccc
gcggtgcatgcctctctggacaaattccttgcctctgtgagcaccgtgctgacctccaag
taccgttaa

DBGET integrated database retrieval system