KEGG   Mus musculus (mouse): 15126Help
Entry
15126             CDS       T01002                                 

Gene name
Hba-x, AI450015, Hbz
Definition
(RefSeq) hemoglobin X, alpha-like embryonic chain in Hba complex
  KO
K13826  hemoglobin subunit zeta
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    15126 (Hba-x)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Globin
Motif
Other DBs
NCBI-GeneID: 15126
NCBI-ProteinID: NP_034535
MGI: 96019
Ensembl: ENSMUSG00000055609
Vega: OTTMUSG00000005373
UniProt: P06467 Q78PA4
Position
11 A4; 11 18.86 cM
AA seq 142 aa AA seqDB search
MSLMKNERAIIMSMWEKMAAQAEPIGTETLERLFCSYPQTKTYFPHFDLHHGSQQLRAHG
FKIMTAVGDAVKSIDNLSSALTKLSELHAYILRVDPVNFKLLSHCLLVTMAARFPADFTP
EVHEAWDKFMSILSSILTEKYR
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgatgaagaatgagagagctatcatcatgtccatgtgggagaagatggctgct
caggccgagcccattggcactgagactctagagaggctcttctgcagctacccccagacg
aagacctacttcccccacttcgacctgcaccatgggtctcagcagttgcgggcccacggc
ttcaagatcatgaccgccgtaggggatgcggttaagagcatcgacaacctctctagtgct
ttgactaagctgagcgagctgcatgcctacatcctgcgtgtggatccggtcaacttcaag
ctcctgtcccactgtctgctggtcacaatggccgcacgctttcccgccgacttcacccct
gaggtccacgaagcctgggacaagttcatgtctatcctgtcttctatcctgactgagaag
taccgctaa

DBGET integrated database retrieval system