KEGG   Mus musculus (house mouse): 15129
Entry
15129             CDS       T01002                                 
Symbol
Hbb-b1, AA409645, Hbb1, Hbbt1, Hbbt2, MommeD7, beta1
Name
(RefSeq) hemoglobin, beta adult major chain
  KO
K13823  hemoglobin subunit beta
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05143  African trypanosomiasis
mmu05144  Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    15129 (Hbb-b1)
   05143 African trypanosomiasis
    15129 (Hbb-b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    15129 (Hbb-b1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    15129 (Hbb-b1)
SSDB
Motif
Pfam: Globin Glycogen_syn
Other DBs
NCBI-GeneID: 15129
NCBI-ProteinID: NP_001265090
MGI: 96021
UniProt: P02088 A8DUK0
Structure
Position
7 E3; 7 54.85 cM
AA seq 147 aa
MVHLTDAEKAAVSCLWGKVNSDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAK
VKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLG
KDFTPAAQAAFQKVVAGVATALAHKYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atggtgcacctgactgatgctgagaaggctgctgtctcttgcctgtggggaaaggtgaac
tccgatgaagttggtggtgaggccctgggcaggctgctggttgtctacccttggacccag
cggtactttgatagctttggagacctatcctctgcctctgctatcatgggtaatgccaaa
gtgaaggcccatggcaagaaggtgataactgcctttaacgatggcctgaatcacttggac
agcctcaagggcacctttgccagcctcagtgagctccactgtgacaagctgcatgtggat
cctgagaacttcaggctcctgggcaatatgatcgtgattgtgctgggccaccacctgggc
aaggatttcacccccgctgcacaggctgccttccagaaggtggtggctggagtggccact
gccctggctcacaagtaccactaa

DBGET integrated database retrieval system