KEGG   Mus musculus (mouse): 15132Help
Entry
15132             CDS       T01002                                 

Gene name
Hbb-bh1, betaH1
Definition
(RefSeq) hemoglobin Z, beta-like embryonic chain
  KO
K13825  hemoglobin subunit epsilon
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    15132 (Hbb-bh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Globin
Motif
Other DBs
NCBI-GeneID: 15132
NCBI-ProteinID: NP_032245
MGI: 96024
Ensembl: ENSMUSG00000052217
Vega: OTTMUSG00000019079
UniProt: P04444 Q5EBL1
Position
7 E3; 7 54.85 cM
AA seq 147 aa AA seqDB search
MVHFTAEEKAAITSIWDKVDLEKVGGETLGRLLIVYPWTQRFFDKFGNLSSALAIMGNPR
IRAHGKKVLTSLGLGVKNMDNLKETFAHLSELHCDKLHVDPENFKLLGNMLVIVLSTHFA
KEFTPEVQAAWQKLVIGVANALSHKYH
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggttcacttcacagctgaggagaaggcagctatcacaagcatctgggataaagtggac
ttggaaaaagttggaggagaaactctgggaaggctcctgattgtttacccatggactcag
agattctttgacaagtttggaaacctctcttctgccctggccatcatgggaaacccccgg
attagagcccatggcaagaaagtgctgacatccttgggcttgggggttaagaacatggac
aacctcaaggagacctttgctcatctcagtgagctgcactgtgacaagcttcatgtggat
cctgagaacttcaagctcctgggcaacatgttggtgattgtcctttctactcattttgcc
aaggaattcaccccagaggtgcaggctgcctggcagaagctggtgattggagtggccaat
gctctgtcccacaagtaccattaa

DBGET integrated database retrieval system