KEGG   Mus musculus (mouse): 15139
Entry
15139             CDS       T01002                                 

Gene name
Hc, C5, C5a, He, Hfib, Hfib2
Definition
(RefSeq) hemolytic complement
  KO
K03994  complement component 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04610  Complement and coagulation cascades
mmu04613  Neutrophil extracellular trap formation
mmu05020  Prion disease
mmu05133  Pertussis
mmu05150  Staphylococcus aureus infection
mmu05168  Herpes simplex virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    15139 (Hc)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    15139 (Hc)
   04613 Neutrophil extracellular trap formation
    15139 (Hc)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    15139 (Hc)
   05168 Herpes simplex virus 1 infection
    15139 (Hc)
  09171 Infectious disease: bacterial
   05133 Pertussis
    15139 (Hc)
   05150 Staphylococcus aureus infection
    15139 (Hc)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    15139 (Hc)
  09164 Neurodegenerative disease
   05020 Prion disease
    15139 (Hc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    15139 (Hc)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   15139 (Hc)
SSDB
Motif
Pfam: TED_complement MG1 MG4 A2M A2M_BRD NTR A2M_recep MG2 MG3 ANATO VIT
Other DBs
NCBI-GeneID: 15139
NCBI-ProteinID: NP_034536
MGI: 96031
Ensembl: ENSMUSG00000026874
Vega: OTTMUSG00000012274
UniProt: P06684
Structure
PDB: 
4P3A 4WB2 4WB3 4P3B

Position
2 B; 2 23.22 cM
AA seq 1680 aa
MGLWGILCLLIFLDKTWGQEQTYVISAPKILRVGSSENVVIQVHGYTEAFDATLSLKSYP
DKKVTFSSGYVNLSPENKFQNAALLTLQPNQVPREESPVSHVYLEVVSKHFSKSKKIPIT
YNNGILFIHTDKPVYTPDQSVKIRVYSLGDDLKPAKRETVLTFIDPEGSEVDIVEENDYT
GIISFPDFKIPSNPKYGVWTIKANYKKDFTTTGTAYFEIKEYVLPRFSVSIELERTFIGY
KNFKNFEITVKARYFYNKVVPDAEVYAFFGLREDIKDEEKQMMHKATQAAKLVDGVAQIS
FDSETAVKELSYNSLEDLNNKYLYIAVTVTESSGGFSEEAEIPGVKYVLSPYTLNLVATP
LFVKPGIPFSIKAQVKDSLEQAVGGVPVTLMAQTVDVNQETSDLETKRSITHDTDGVAVF
VLNLPSNVTVLKFEIRTDDPELPEENQASKEYEAVAYSSLSQSYIYIAWTENYKPMLVGE
YLNIMVTPKSPYIDKITHYNYLILSKGKIVQYGTREKLFSSTYQNINIPVTQNMVPSARL
LVYYIVTGEQTAELVADAVWINIEEKCGNQLQVHLSPDEYVYSPGQTVSLDMVTEADSWV
ALSAVDRAVYKVQGNAKRAMQRVFQALDEKSDLGCGAGGGHDNADVFHLAGLTFLTNANA
DDSHYRDDSCKEILRSKRNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVA
RVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGRIHIKTLLPVMKADIRSYFPESWLWE
IHRVPKRKQLQVTLPDSLTTWEIQGIGISDNGICVADTLKAKVFKEVFLEMNIPYSVVRG
EQIQLKGTVYNYMTSGTKFCVKMSAVEGICTSGSSAASLHTSRPSRCVFQRIEGSSSHLV
TFTLLPLEIGLHSINFSLETSFGKDILVKTLRVVPEGVKRESYAGVILDPKGIRGIVNRR
KEFPYRIPLDLVPKTKVERILSVKGLLVGEFLSTVLSKEGINILTHLPKGSAEAELMSIA
PVFYVFHYLEAGNHWNIFYPDTLSKRQSLEKKIKQGVVSVMSYRNADYSYSMWKGASAST
WLTAFALRVLGQVAKYVKQDENSICNSLLWLVEKCQLENGSFKENSQYLPIKLQGTLPAE
AQEKTLYLTAFSVIGIRKAVDICPTMKIHTALDKADSFLLENTLPSKSTFTLAIVAYALS
LGDRTHPRFRLIVSALRKEAFVKGDPPIYRYWRDTLKRPDSSVPSSGTAGMVETTAYALL
ASLKLKDMNYANPIIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLLKQIHLDMDINVA
YKHEGDFHKYKVTEKHFLGRPVEVSLNDDLVVSTGYSSGLATVYVKTVVHKISVSEEFCS
FYLKIDTQDIEASSHFRLSDSGFKRIIACASYKPSKEESTSGSSHAVMDISLPTGIGANE
EDLRALVEGVDQLLTDYQIKDGHVILQLNSIPSRDFLCVRFRIFELFQVGFLNPATFTVY
EYHRPDKQCTMIYSISDTRLQKVCEGAACTCVEADCAQLQAEVDLAISADSRKEKACKPE
TAYAYKVRITSATEENVFVKYTATLLVTYKTGEAADENSEVTFIKKMSCTNANLVKGKQY
LIMGKEVLQIKHNFSFKYIYPLDSSTWIEYWPTDTTCPSCQAFVENLNNFAEDLFLNSCE
NT seq 5043 nt   +upstreamnt  +downstreamnt
atgggtctttggggaatactttgtcttttaattttcctggacaaaacttggggacaggaa
caaacctacgtcatttcagcacccaaaatcctccgggtcggctcgtctgaaaatgtggta
attcaagtccatggctacactgaagcatttgatgcaactctttctctaaaaagctatcct
gacaaaaaagtcaccttctcttcaggctatgttaatttgtccccggaaaacaaattccaa
aacgcggcactgttgacactacagcccaatcaagttcctagagaagaaagcccagtctct
cacgtgtatctggaagttgtgtcaaaacacttttcaaaatcaaagaaaataccaattacc
tataacaatggaattctcttcatccatacagacaaacctgtttacacgccggaccagtca
gtaaagatcagagtctattctctgggtgacgacttgaagccagccaaacgggagactgtc
ttaactttcatagaccccgaaggatcagaagttgacattgtagaagaaaatgattacacc
ggaattatctcttttcctgacttcaagattccatctaatcccaagtatggtgtttggaca
attaaagctaactataagaaggattttacaacaactggaactgcatactttgaaattaaa
gaatatgtcttgccacgattctctgtttcaatagaactagaaagaaccttcattggctat
aaaaactttaagaactttgaaatcactgtgaaagcaagatatttttataataaagtggta
cctgatgctgaagtgtatgccttttttggattgagagaggacataaaagatgaggagaag
cagatgatgcacaaagccacacaagccgcaaagttggttgacggagttgctcagatctct
tttgattctgaaacagcagttaaagagctgtcctacaacagtctagaagacttaaacaac
aagtacctttatattgcagtaacagtcacagaatcttcaggtggattttcagaagaggca
gaaatccctggagtcaaatatgtcctctctccctacacactgaatttggtcgctactcct
cttttcgtgaagcccgggattccattttccatcaaggcacaggttaaagattcactcgag
caggcggtaggaggggtcccagtaactctgatggcacaaacagtcgatgtgaatcaagag
acatctgacttggaaacaaagaggagcatcactcatgacactgatggagtagctgtgttt
gtgctgaacctcccatcaaatgtgacggtgctaaagtttgagatcagaactgatgaccca
gaacttcccgaagaaaatcaagccagcaaagagtacgaagcagttgcgtactcgtctctc
agccaaagttacatttacatcgcttggactgaaaactacaagcccatgcttgtgggagaa
tacctgaatattatggttacccccaagagcccatatatcgacaaaataactcactataat
tacttgattttatccaaaggcaaaattgtacagtacggcacaagagagaaacttttctcc
tcaacttatcaaaatataaatattccagtgacacagaacatggttccttcagcacgactc
ctggtctattacatagtcacaggggagcaaacagcagaattagtggctgacgcagtctgg
ataaatattgaggagaagtgtggcaaccagctccaggtccatctgtctccagatgaatat
gtgtattctccaggccaaactgtgtcccttgacatggtgactgaagcagactcatgggta
gcactatcagcagtggacagagctgtgtataaagtccagggaaacgccaaaagggccatg
caaagagtctttcaagctttggatgaaaagagtgacctgggctgtggggcaggtggtggc
catgacaatgcagatgtattccatctagctgggctcaccttcctcaccaacgcaaacgca
gatgactcccattatcgtgatgactcttgtaaagaaattctcaggtcaaagagaaacctg
catctcctaaggcagaaaatagaagaacaagctgctaagtacaaacatagtgtgccaaag
aaatgctgctatgacggagcccgagtgaacttctacgaaacctgtgaggagcgagtggcc
cgggttaccataggccctctctgcatcagggccttcaacgagtgctgtactattgcgaac
aagatccgaaaagaaagcccccataaacctgtccaactgggaaggatccacattaagacc
ctgttaccagtgatgaaggcagatatccgaagctactttccagagagctggctatgggaa
attcatcgcgttcccaaaagaaaacagctgcaggtcacgctgcctgactcactaacgact
tgggaaattcaaggcattggcatttcagacaatggtatatgtgttgctgatacactcaag
gcaaaggtgttcaaagaagtcttcctggagatgaacataccatattctgttgtgcgagga
gaacagatccaattgaaaggaactgtttacaactatatgacctcagggacaaagttctgt
gttaaaatgtctgctgtggaggggatctgcacttcaggaagctcagctgctagccttcac
acctccaggccctccagatgtgtgttccagaggatagagggctcgtccagtcacttggtg
accttcaccctgcttcctctggaaattggccttcactccataaacttctcactagagacc
tcatttgggaaagacatcttagtaaagacattacgggtagtgccagaaggagtcaagagg
gaaagctatgccggcgtgattctggaccctaagggaattcgtggtattgttaacagacga
aaggaattcccatacaggatcccattagatttggtccccaagaccaaagttgaaaggatt
ttgagtgtcaaaggactgcttgtaggggagttcttgtccacggttctgagtaaggaaggc
atcaacatcctaacccacctccccaagggcagtgcagaggcagagctcatgagcatagct
ccggtgttctatgttttccactacctggaagcaggaaaccattggaatattttctatcct
gatacactgagtaaaagacagagcctggagaaaaaaataaaacaaggggtggtgagcgtc
atgtcctacagaaacgctgactattcctacagcatgtggaagggggcgagcgctagtacc
tggctgacagcttttgctctgagagtgcttggacaggtggccaagtatgtaaaacaggat
gaaaactcaatttgtaactctttgctatggctggttgagaagtgtcagctggaaaacggc
tctttcaaggaaaattcccaatatctaccaataaaattacagggtactttgcctgctgaa
gcccaagagaaaactttgtatcttacagccttttctgtgattggaattagaaaggcagtt
gacatatgccccaccatgaaaatccacacagcgctagataaagccgactccttcctgctt
gaaaacaccctgccatccaagagcaccttcacactggccattgtagcctatgctctttcc
ctaggagacagaacccacccgaggtttcgtctaattgtgtcggccctgaggaaggaagct
tttgttaaaggtgatccgcccatttaccgttactggagagataccctcaaacgtccagac
agctctgtgcccagcagcggcacagcaggtatggttgaaaccacagcctatgctttgctc
gccagcctgaaactgaaggatatgaattacgccaaccccatcatcaagtggctatctgaa
gagcagaggtatggaggcggcttttattccacccaggatacgattaatgccatcgagggc
ctgacagaatattcactcctgttaaaacaaattcatttggatatggacatcaatgtcgcc
tacaaacacgaaggtgacttccacaagtataaggtgacagagaagcatttcctggggagg
ccagtggaggtatctctcaatgatgaccttgttgtcagcacaggctacagcagtggcttg
gccacagtatatgtaaaaactgtggttcacaaaattagtgtctctgaggaattttgcagc
ttttacttgaaaattgatacccaagatattgaagcatccagccacttcaggctcagtgac
tctggattcaagcgcataatagcatgtgccagctacaagcccagcaaggaggagtcaaca
tccgggtcctcccatgcagtaatggatatatcactgccgactggaatcggagcaaacgag
gaagatttacgggctcttgtggaaggagtggatcaactactaactgattaccagatcaaa
gatggccatgtcattctgcaactgaattcgatcccctccagagatttcctctgtgtccgg
ttccggatatttgaacttttccaagttgggtttctgaatcctgctaccttcacggtgtac
gagtatcacagaccagataagcagtgcaccatgatttatagcatttctgacaccaggctt
cagaaagtctgtgaaggagcagcttgcacatgtgtggaagctgactgtgcgcaactgcag
gcagaagtagacctagccatctctgcagactccagaaaagagaaagcctgtaaaccagag
actgcatatgcttataaagtcaggatcacatcagccactgaagaaaatgtttttgtcaag
tacactgcgactcttctggtcacttacaaaacaggggaagctgctgatgagaattcggag
gtcaccttcattaaaaagatgagctgtaccaatgccaacctggtgaaagggaagcagtat
ttaatcatgggcaaagaggttctgcagatcaaacacaatttcagtttcaagtatatatac
cctctagattcctccacctggattgaatattggcccacagacacaacgtgtccatcctgt
caagcatttgtagagaatttgaataactttgctgaagacctctttttaaacagctgtgaa
tga

DBGET integrated database retrieval system